Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Desulfovibrio salexigens DSM 2638  

Data for CP001649  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP001649.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001649_3254 CDS_3641376-3643700 104.5 2.6e-29 1
CP001649_2850 CDS_3176611-3179382 102.4 1.1e-28 1
CP001649_3280 CDS_3677978-3672966 99.1 9e-28 1
CP001649_3306 CDS_3711446-3715573 95.8 7.6e-27 1
CP001649_3310 CDS_3719285-3717126 95.2 1.1e-26 1
CP001649_3333 CDS_3750166-3748460 95.2 1.2e-26 1
CP001649_0539 CDS_594769-592811 94.5 1.9e-26 1
CP001649_3074 CDS_3445434-3442318 91.4 1.4e-25 2
CP001649_3082 CDS_3454650-3451630 90.8 2e-25 1
CP001649_1716 CDS_1886339-1888294 89.2 6e-25 1
CP001649_0124 CDS_141346-134945 89.1 6.2e-25 2
CP001649_1462 CDS_1609541-1611520 88.1 1.2e-24 1
CP001649_1282 CDS_1421983-1424451 87.5 1.7e-24 1
CP001649_3668 CDS_4140040-4138250 87.4 1.8e-24 1
CP001649_0769 CDS_860803-859175 87.1 2.3e-24 1
CP001649_2995 CDS_3345345-3342970 87.1 2.3e-24 1
CP001649_2659 CDS_2929913-2932180 84.3 1.4e-23 1
CP001649_3463 CDS_3898358-3896082 83.6 2.2e-23 1
CP001649_0950 CDS_1078965-1076557 80.9 1.3e-22 1
CP001649_3242 CDS_3629188-3625937 79.8 2.7e-22 1
CP001649_1107 CDS_1240804-1238306 74.0 1.2e-20 1
CP001649_3743 CDS_4219388-4217955 65.7 2.6e-18 1
CP001649_2358 CDS_2604223-2606151 62.8 1.8e-17 1
CP001649_0672 CDS_737721-735988 62.4 2.2e-17 1
CP001649_0094 CDS_103333-101513 61.1 5.3e-17 1
CP001649_3542 CDS_3992689-3991244 57.5 5.5e-16 1
CP001649_3388 CDS_3815254-3813947 55.4 2.2e-15 1
CP001649_0283 CDS_308270-307089 53.1 9.8e-15 1
CP001649_2176 CDS_2406910-2405414 53.0 1.1e-14 1
CP001649_3031 CDS_3396672-3398054 52.8 1.2e-14 1
CP001649_0408 CDS_446640-444205 50.9 4.2e-14 1
CP001649_3773 CDS_4252285-4254957 50.1 7.1e-14 1
CP001649_3651 CDS_4114930-4117122 49.3 1.2e-13 1
CP001649_2623 CDS_2892309-2893073 48.0 2.8e-13 1
CP001649_3125 CDS_3499595-3501718 47.2 4.7e-13 1
CP001649_0878 CDS_989559-991823 47.2 4.7e-13 1
CP001649_2559 CDS_2827808-2825148 44.5 2.7e-12 1
CP001649_0381 CDS_416172-414757 43.5 5.2e-12 1
CP001649_3643 CDS_4105722-4103347 41.9 1.5e-11 1
CP001649_1429 CDS_1570289-1572607 38.6 1.2e-10 2
CP001649_0543 CDS_601298-599898 38.3 1.5e-10 2
CP001649_3378 CDS_3804966-3803134 37.9 2e-10 1
CP001649_2048 CDS_2261733-2259028 37.8 2.1e-10 1
CP001649_1113 CDS_1246788-1248818 37.5 2.6e-10 1
CP001649_1856 CDS_2047135-2048049 36.2 6.2e-10 1
CP001649_1877 CDS_2071193-2068896 36.0 7e-10 1
CP001649_3129 CDS_3507106-3508998 34.5 1.8e-09 2
CP001649_0711 CDS_789500-787083 33.9 2.7e-09 1
CP001649_3013 CDS_3366211-3364235 33.8 2.9e-09 1
CP001649_1854 CDS_2045071-2046753 33.2 4.3e-09 1
CP001649_2624 CDS_2895356-2893197 33.2 4.3e-09 1
CP001649_3105 CDS_3477788-3479203 32.1 8.7e-09 1
CP001649_0492 CDS_540702-542342 31.8 1e-08 1
CP001649_1357 CDS_1501332-1499062 31.8 1e-08 1
CP001649_2182 CDS_2412008-2410254 31.5 1.3e-08 1
CP001649_0340 CDS_369298-367013 30.8 2.1e-08 1
CP001649_3659 CDS_4127622-4130156 30.7 2.2e-08 1
CP001649_2872 CDS_3204450-3202168 30.5 2.5e-08 2
CP001649_1124 CDS_1262306-1264045 28.9 6.9e-08 1
CP001649_3660 CDS_4131572-4130115 28.1 1.2e-07 1
CP001649_2304 CDS_2550956-2548851 28.1 1.2e-07 2
CP001649_1443 CDS_1586337-1587491 27.9 1.3e-07 1
CP001649_3126 CDS_3503938-3501752 27.8 1.4e-07 1
CP001649_0360 CDS_390744-391856 27.1 2.3e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001649_3254 1/1 266 331 .. 1 87 [] 104.5 2.6e-29
CP001649_2850 1/1 276 341 .. 1 87 [] 102.4 1.1e-28
CP001649_3280 1/1 940 1005 .. 1 87 [] 99.1 9e-28
CP001649_3306 1/1 869 934 .. 1 87 [] 95.8 7.6e-27
CP001649_3310 1/1 346 411 .. 1 87 [] 95.2 1.1e-26
CP001649_3333 1/1 344 409 .. 1 87 [] 95.2 1.2e-26
CP001649_0539 1/1 269 334 .. 1 87 [] 94.5 1.9e-26
CP001649_3074 2/2 664 729 .. 1 87 [] 91.3 1.5e-25
CP001649_3082 1/1 499 564 .. 1 87 [] 90.8 2e-25
CP001649_1716 1/1 142 207 .. 1 87 [] 89.2 6e-25
CP001649_0124 2/2 1616 1681 .. 1 87 [] 88.6 8.7e-25
CP001649_1462 1/1 299 364 .. 1 87 [] 88.1 1.2e-24
CP001649_1282 1/1 322 387 .. 1 87 [] 87.5 1.7e-24
CP001649_3668 1/1 365 432 .. 1 87 [] 87.4 1.8e-24
CP001649_0769 1/1 172 237 .. 1 87 [] 87.1 2.3e-24
CP001649_2995 1/1 281 346 .. 1 87 [] 87.1 2.3e-24
CP001649_2659 1/1 377 442 .. 1 87 [] 84.3 1.4e-23
CP001649_3463 1/1 384 449 .. 1 87 [] 83.6 2.2e-23
CP001649_0950 1/1 429 494 .. 1 87 [] 80.9 1.3e-22
CP001649_3242 1/1 491 557 .. 1 87 [] 79.8 2.7e-22
CP001649_1107 1/1 374 456 .. 1 87 [] 74.0 1.2e-20
CP001649_3743 1/1 261 328 .. 1 87 [] 65.7 2.6e-18
CP001649_2358 1/1 406 472 .. 1 87 [] 62.8 1.8e-17
CP001649_0672 1/1 355 421 .. 1 87 [] 62.4 2.2e-17
CP001649_0094 1/1 363 430 .. 1 87 [] 61.1 5.3e-17
CP001649_3542 1/1 265 331 .. 1 87 [] 57.5 5.5e-16
CP001649_3388 1/1 220 287 .. 1 87 [] 55.4 2.2e-15
CP001649_0283 1/1 169 244 .. 1 87 [] 53.1 9.8e-15
CP001649_2176 1/1 276 342 .. 1 87 [] 53.0 1.1e-14
CP001649_3031 1/1 238 306 .. 1 87 [] 52.8 1.2e-14
CP001649_0408 1/1 587 651 .. 1 87 [] 50.9 4.2e-14
CP001649_3773 1/1 673 731 .. 9 87 .] 50.1 7.1e-14
CP001649_3651 1/1 513 582 .. 1 87 [] 49.3 1.2e-13
CP001649_2623 1/1 131 195 .. 1 87 [] 48.0 2.8e-13
CP001649_3125 1/1 455 545 .. 1 87 [] 47.2 4.7e-13
CP001649_0878 1/1 491 581 .. 1 87 [] 47.2 4.7e-13
CP001649_2559 1/1 510 576 .. 1 87 [] 44.5 2.7e-12
CP001649_0381 1/1 251 318 .. 1 87 [] 43.5 5.2e-12
CP001649_3643 1/1 420 486 .. 1 87 [] 41.9 1.5e-11
CP001649_3378 1/1 354 444 .. 1 87 [] 37.9 2e-10
CP001649_2048 1/1 635 725 .. 1 87 [] 37.8 2.1e-10
CP001649_1113 1/1 443 514 .. 1 87 [] 37.5 2.6e-10
CP001649_1856 1/1 78 150 .. 1 87 [] 36.2 6.2e-10
CP001649_1877 1/1 514 604 .. 1 87 [] 36.0 7e-10
CP001649_0711 1/1 553 643 .. 1 87 [] 33.9 2.7e-09
CP001649_3013 1/1 322 381 .. 5 87 .] 33.8 2.9e-09
CP001649_1854 1/1 324 398 .. 1 87 [] 33.2 4.3e-09
CP001649_2624 1/1 519 585 .. 1 87 [] 33.2 4.3e-09
CP001649_3105 1/1 245 311 .. 1 87 [] 32.1 8.7e-09
CP001649_0492 1/1 327 387 .. 9 87 .] 31.8 1e-08
CP001649_1357 1/1 521 588 .. 1 83 [. 31.8 1e-08
CP001649_1429 1/2 518 563 .. 1 68 [. 31.5 1.3e-08
CP001649_2182 1/1 338 411 .. 1 87 [] 31.5 1.3e-08
CP001649_0340 1/1 529 600 .. 1 87 [] 30.8 2.1e-08
CP001649_3659 1/1 591 681 .. 1 87 [] 30.7 2.2e-08
CP001649_1124 1/1 350 418 .. 1 83 [. 28.9 6.9e-08
CP001649_3660 1/1 252 317 .. 1 87 [] 28.1 1.2e-07
CP001649_1443 1/1 171 237 .. 1 87 [] 27.9 1.3e-07
CP001649_3126 1/1 472 562 .. 1 87 [] 27.8 1.4e-07
CP001649_0543 1/2 205 229 .. 1 25 [. 27.5 1.8e-07
CP001649_0360 1/1 147 210 .. 8 87 .] 27.1 2.3e-07

Alignments of top-scoring domains:
CP001649_3254: domain 1 of 1, from 266 to 331: score 104.5, E = 2.6e-29
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHE+RTP++aI+g+ae+L + ++l++eq
CP001649_3 266 AKSQFLAAMSHEIRTPMNAILGMAEILAD---------SHLDDEQ-- 301

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++e++++++e+ll+Lin++Ldls+ieag
CP001649_3 302 ----------RRFVEILQESGESLLHLINEILDLSKIEAG 331

CP001649_2850: domain 1 of 1, from 276 to 341: score 102.4, E = 1.1e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ksef+an+sHE+RTP++aI+g+a+l e t+ls++q
CP001649_2 276 SKSEFMANVSHEIRTPMNAIIGMADLTME---------TDLSSKQ-- 311

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re++++i+++++ llrLind+Ld+s+ieag
CP001649_2 312 ----------REFIKIIISSGKVLLRLINDILDFSKIEAG 341

CP001649_3280: domain 1 of 1, from 940 to 1005: score 99.1, E = 9e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTP+++I+g+ +l++ ++l++ q
CP001649_3 940 AKSEFLANMSHEIRTPMNSIIGFGHLMQS---------ADLDSAQ-- 975

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyl+++ ++a++ll++i d+Ld+s+ieag
CP001649_3 976 ----------REYLNKMMSSADSLLSIIGDILDFSKIEAG 1005

CP001649_3306: domain 1 of 1, from 869 to 934: score 95.8, E = 7.6e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+RTPL++I+g a+lL++ t+ls+eq
CP001649_3 869 AKSAFLASMSHEIRTPLNSILGVADLLKN---------TDLSDEQ-- 904

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey+++ ++++e ll +ind+Ld+s+iea+
CP001649_3 905 ----------GEYVNIFESSGEILLTIINDILDFSKIEAN 934

CP001649_3310: domain 1 of 1, from 346 to 411: score 95.2, E = 1.1e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTP++aI+g++e+ l+ t+l+ eq
CP001649_3 346 AKSEFLANMSHEIRTPISAIIGMSEMTLN---------TNLTGEQ-- 381

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ yl t++++ae+ll++ind+Ld+s+iea
CP001649_3 382 ----------QGYLVTVKKAAESLLHIINDILDISKIEAR 411

CP001649_3333: domain 1 of 1, from 344 to 409: score 95.2, E = 1.2e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+eflan+sHE+RTP+++I+g++elL+e t+ +eeq
CP001649_3 344 VKTEFLANMSHEIRTPMHSILGMVELLKE---------TNVDEEQ-- 379

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l+++ ++e+ll++ind+L++s+ieag
CP001649_3 380 ----------REFLNIAGTAGESLLEIINDVLEISKIEAG 409

CP001649_0539: domain 1 of 1, from 269 to 334: score 94.5, E = 1.9e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHE+RTPL++I+g+++l++ ++++++q
CP001649_0 269 TKSEFLANMSHEIRTPLNGIMGMLQLMES---------ETQTPKQ-- 304

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey++ + ++++rl++ ++d+Ldl+r eag
CP001649_0 305 ----------GEYVNAAMQASKRLNNVLSDILDLARVEAG 334

CP001649_3074: domain 2 of 2, from 664 to 729: score 91.3, E = 1.5e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++flan+ HE+RTP++a++g+++lL++ +el++eq
CP001649_3 664 AKGRFLANMTHEFRTPMNAVKGMVQLLQR---------SELTSEQ-- 699

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e l+ i++++++ll ++nd+Ld+s++++
CP001649_3 700 ----------QENLRLIKSSVDSLLVIVNDILDYSKLDSV 729

CP001649_3082: domain 1 of 1, from 499 to 564: score 90.8, E = 2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ksefla +sHE+RTP+++I+g+a++L + t l++eq
CP001649_3 499 TKSEFLAQMSHEIRTPMNSILGMADMLTD---------TRLTSEQ-- 534

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y+++ +++++ ll+Li+d+Ldls+ie+g
CP001649_3 535 ----------RNYVSIFRDSGKALLNLIDDILDLSKIESG 564

CP001649_1716: domain 1 of 1, from 142 to 207: score 89.2, E = 6e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHELRTP+++I+g++e+Ll + l +eq
CP001649_1 142 AKSSFLATISHELRTPMNGILGLSEILLS---------SGLASEQ-- 177

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ey+e i+ +a +llr +nd+Ld+s+ie
CP001649_1 178 ----------KEYVELIKGSASSLLRVLNDMLDYSKIERR 207

CP001649_0124: domain 2 of 2, from 1616 to 1681: score 88.6, E = 8.7e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHE+RTP++aI+g+a+lL e + ls q
CP001649_0 1616 AKSDFLASMSHEIRTPMNAILGMADLLWE---------SRLSKIQ-- 1651

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y+++ ++++e ll Lind+Ldls+ieag
CP001649_0 1652 ----------RNYVKIFRNAGENLLLLINDILDLSKIEAG 1681

CP001649_1462: domain 1 of 1, from 299 to 364: score 88.1, E = 1.2e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHE+RTP+++I+g+++lL++ t+l++eq
CP001649_1 299 VKSEFLANMSHEIRTPINGIMGMLQLLKT---------TDLDAEQ-- 334

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey++ +l+++ rl++L+ d+Ldl+ eag
CP001649_1 335 ----------LEYVDYALKSSSRLSSLLIDILDLTMVEAG 364

CP001649_1282: domain 1 of 1, from 322 to 387: score 87.5, E = 1.7e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+fla++sHE+RTPL+aI+g+++l l+ +els +q
CP001649_1 322 FKSRFLASMSHEIRTPLNAIIGLTDLTLR---------SELSTKQ-- 357

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e le ++ +a++ll Lind+Ldls+ ea
CP001649_1 358 ----------AEDLELVKISADQLLTLINDILDLSKVEAR 387

CP001649_3668: domain 1 of 1, from 365 to 432: score 87.4, E = 1.8e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTPLt+++gyae+Ll ++ ++e ++
CP001649_3 365 VRQDFVANVSHELRTPLTSVKGYAETLLS---------DPPPPESIQ 402

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l ti++ a+++ ++++dlL lsr+e+g
CP001649_3 403 ----------KNFLATIEKNANHMCKIVDDLLNLSRLESG 432

CP001649_0769: domain 1 of 1, from 172 to 237: score 87.1, E = 2.3e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++++g+++lL+ ++ e+q
CP001649_0 172 AKSEFLANMSHEIRTPLNGVLGMLQLLKS---------APEKEKQ-- 207

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey+e + ++rl L++d+Ldlsr eag
CP001649_0 208 ----------LEYIELAVTGVKRLTTLLSDILDLSRVEAG 237

CP001649_2995: domain 1 of 1, from 281 to 346: score 87.1, E = 2.3e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+fla++sHE+RTP++aI+g+ +lLl tel++eq
CP001649_2 281 FKSQFLAMISHEIRTPMNAILGMGDLLLG---------TELDPEQ-- 316

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y+e+ + ++e ll++ind+Ld+ +ie+g
CP001649_2 317 ----------MGYVEIFRGSGELLLKIINDILDFVQIESG 346

CP001649_2659: domain 1 of 1, from 377 to 442: score 84.3, E = 1.4e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla +sHE+RTP+++I+g+++lL++ ++ ++q
CP001649_2 377 AKSQFLAVMSHEIRTPMNVILGTTDLLKD---------SHPRDDQ-- 412

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y++ +++++e ll+Lind+Ld+s+ eag
CP001649_2 413 ----------KKYIKLLDDAGEGLLALINDILDMSKVEAG 442

CP001649_3463: domain 1 of 1, from 384 to 449: score 83.6, E = 2.2e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++I+g+++l+++ +e++ +q
CP001649_3 384 AKSEFLANMSHEIRTPLNGIMGMLQLMRM---------GEMNQKQ-- 419

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e + ++ +rl++L+ d+Ld++rie+g
CP001649_3 420 ----------EEQCGFAMESCKRLNKLLGDILDITRIESG 449

CP001649_0950: domain 1 of 1, from 429 to 494: score 80.9, E = 1.3e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+eflan+sHE+RTPL++++g+++++ ++l+ e+
CP001649_0 429 TKDEFLANISHEIRTPLNGVMGMLQVMNS---------AKLNQEH-- 464

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++++l++++ llr ++d+Ldls+ e g
CP001649_0 465 ----------RNCISVALQSSRNLLRVLDDILDLSKVEMG 494

CP001649_3242: domain 1 of 1, from 491 to 557: score 79.8, E = 2.7e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k f+an+sHE+RTP++aI+g+ae+ d++ls+++
CP001649_3 491 VKAAFTANMSHEIRTPINAILGFAEVVMQ--------DSDLSSQT-- 527

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + til++a++ll +ind+Ld s++e+g
CP001649_3 528 ----------AGHVGTILSSAKSLLGIINDILDVSKMESG 557

CP001649_1107: domain 1 of 1, from 374 to 456: score 74.0, E = 1.2e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldk......v.lagdte
k++f++++sHELRTP+t+I+g+a++++++l+k+ + + te
CP001649_1 374 LKTDFISTVSHELRTPMTSILGFAKIIKKKLEKsvfpvcNaPDKKTE 420

lseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ q+ ++ + +i +e++rl +Lind+Ld++++e+g
CP001649_1 421 RAINQV-----------KDNIGIIVSEGQRLTELINDVLDIAKMESG 456

CP001649_3743: domain 1 of 1, from 261 to 328: score 65.7, E = 2.6e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++++++HE+R+PL Ir +elLl+++ e ++
CP001649_3 261 SIGRMVSGVAHEIRNPLGIIRSSSELLLKRM-------KESDPVN-- 298

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l i++e++rl+r ++d+Ld++r +
CP001649_3 299 ----------VKILGAIHEETKRLSRTVSDFLDYARPRKI 328

CP001649_2358: domain 1 of 1, from 406 to 472: score 62.8, E = 1.8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ +++HE++TPL I+gya+lL+e + ++++q+
CP001649_2 406 SIGKLAGGVAHEINTPLGIILGYAQLLKE---------DFKPDDQI- 442

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ le+i+++a+ +++++ dlL +sr +
CP001649_2 443 ----------SKDLEIIEKQARVCRKIVADLLGFSRQNES 472

CP001649_0672: domain 1 of 1, from 355 to 421: score 62.4, E = 2.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+R+PL+++rg+a+l + + eeq
CP001649_0 355 SIGSLAAGVAHEIRNPLSSLRGFAQLFAD----------KFKEEQP- 390

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y y t+l ea+rl+r + dlL ls+ +
CP001649_0 391 ---------YGTYATTMLTEADRLNRVVTDLLYLSKPHEL 421

CP001649_0094: domain 1 of 1, from 363 to 430: score 61.1, E = 5.3e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f++n+sH+LRTPLt+I+gy+e+L + + ++++l
CP001649_0 363 ILRDFVSNASHQLRTPLTSIKGYSETLID---------NPPQDQKIL 400

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l til+ a+++++ i + l+r e
CP001649_0 401 ----------TSFLGTILDNANHMSKVITSMFALTRSEYS 430

CP001649_3542: domain 1 of 1, from 265 to 331: score 57.5, E = 5.5e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+e+ a+++HE+R+PL a+ g+a++L + d+ +++
CP001649_3 265 TVGELSAYIAHEIRNPLMAMGGFAKVLIK--------DESIDAPG-- 301

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re +++il+ea+rl+rL+ +L + r +
CP001649_3 302 ----------REKIQIILEEAQRLDRLLKSILSFVRSRDV 331

CP001649_3388: domain 1 of 1, from 220 to 287: score 55.4, E = 2.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f++++sHELRTPL++I+g++el++ + + +s+e
CP001649_3 220 REKDFTRDVSHELRTPLSVIKGALELIRL-------SPSSKSSEM-- 257

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +i+r+++ +++ i+ lL ++r e+
CP001649_3 258 ----------QKPLGRIERSVKDMEETIETLLWIAREENK 287

CP001649_0283: domain 1 of 1, from 169 to 244: score 53.1, E = 9.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
+ ++a+++HE+++P++a+ g+ae ++++l +++ + +el e+
CP001649_0 169 TIGVLAAGVAHEINNPMAAVAGFAEGIQRRLTRLdDKIPDELAEDL- 214

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+y++til+e r+++++ lL +sr a
CP001649_0 215 -----------YDYTNTILKECLRCQDIVKTLLSFSRPVAS 244

CP001649_2176: domain 1 of 1, from 276 to 342: score 53.0, E = 1.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++f a+++HE++ PL+ I+gya+l+l t+ ++q+
CP001649_2 276 KIGQFSAGVAHEINEPLANILGYAQLALQ---------TPELPDQV- 312

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l+ i +++ + +++i ++ +sr +
CP001649_2 313 ----------RMDLDNIVDSSLHAREIIKKIMFFSRQLPP 342

CP001649_3031: domain 1 of 1, from 238 to 306: score 52.8, E = 1.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +e++an+sHELR PL+ +r +e+L+e+ + t ++
CP001649_3 238 SSRELTANVSHELRSPLARMRISLEMLKERIE------TGNTSGC-- 276

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +++e+ ++++Li + ++s++e
CP001649_3 277 ----------DTFVDGMQSEITHMDELIGKIIEFSKLEMH 306

CP001649_0408: domain 1 of 1, from 587 to 651: score 50.9, E = 4.2e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ a+l+HE+++PL +I+ yaelL++ +s +
CP001649_0 587 TVGKLSAGLAHEINNPLGVILCYAELLKK----------GASGQS-- 621

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e +e+il+ +++ + + dlL ++r
CP001649_0 622 ----------AEDIEVILKHTRQAQTVLKDLLNFARPKVS 651

CP001649_3773: domain 1 of 1, from 673 to 731: score 50.1, E = 7.1e-14
*->lsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledp
++H+L+TPL++I+g+ lL++ d++l+e+q
CP001649_3 673 MRHDLKTPLNGIIGLPGLLRM--------DDNLTEQQ---------- 701

eyreyletilreaerllrLindlLdlsrieag<-*
+++l+ti+++++ +l++i+ Ld+ ++e+g
CP001649_3 702 --HKLLKTIENSGKKMLHMIEMSLDMFKMETG 731

CP001649_3651: domain 1 of 1, from 513 to 582: score 49.3, E = 1.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e ++ ++HE+++PLt I++ a+ L++++ +e +
CP001649_3 513 AWREVARRIAHEIKNPLTPIKLSAQRLQRKFG------QEIEDNV-- 551

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+re ++ i++++e+l+++++++ ++++ +
CP001649_3 552 ---------FRESTDLIISQVEHLQQMVQEFSAYAKLPEV 582

CP001649_2623: domain 1 of 1, from 131 to 195: score 48.0, E = 2.8e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ efl+ l HE+RTPL++I+g+++l+ + t+l++eq+
CP001649_2 131 SAIEFLRILNHEIRTPLNGIMGMLQLMSD---------TTLNAEQI- 167

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l++ +a+rl++ ++ L lsr
CP001649_2 168 -----------NFLNIGATAANRLNSFVDI-LSLSRSTKD 195

CP001649_3125: domain 1 of 1, from 455 to 545: score 47.2, E = 4.7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldk.....v.lagdtel
+ + ++a+++HE+++PL++I+g+++ ++++l+ +++ + ++a+ +
CP001649_3 455 SIGGLAAGMAHEINNPLAGILGHSQNIRNRLFNstkanIrAAEKHGI 501

seeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +q++++ d+e+ ++++ i+ +++r ++++++L +sr +
CP001649_3 502 DLQQIQDYM--TDREIPRMIDGIRTAGNRAAKIVSNMLSFSRQSEK 545

CP001649_0878: domain 1 of 1, from 491 to 581: score 47.2, E = 4.7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldk..............
+++ ++a+++HE+++PL+aI g ++ L+++l k+++ + + ++ ++
CP001649_0 491 SLGGLAAGMAHEINNPLAAIVGSCQNLRNRLLKenpmnikiaeecgt 537

.....v.lagdtelseeqrlpeLRledpeyreyletilreaerllrLind
+ ++ v++a+ ++ +++e+i+++++r +++ d
CP001649_0 538 sfdnmVsYAQARDC----------------DKMVESIYESGKRAADIVKD 571

lLdlsrieag<-*
+L +sr
CP001649_0 572 MLSFSRQSDK 581

CP001649_2559: domain 1 of 1, from 510 to 576: score 44.5, E = 2.7e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++ +++H++++ Lt+I+ +el+l + e+++
CP001649_2 510 AIGTLAGGIAHDFNNILTSIMNSVELALS----------DIEEDTIT 546

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++++++a+r +r + ++L++sr ++
CP001649_2 547 ----------WKDLDRAIKAAQRGSRVVKQILTFSRPSQE 576

CP001649_0381: domain 1 of 1, from 251 to 318: score 43.5, E = 5.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + + ++++H+L++PL+ I++ +++L+e++ ++e
CP001649_0 251 SIGTLSSGIAHQLNNPLNNISTSCQILEERQ-------KGQDELS-- 288

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + i +e+ r ++++ lL++sr +
CP001649_0 289 ----------DRMMNNIMQETLRARDIVKGLLEFSRESEY 318

CP001649_3643: domain 1 of 1, from 420 to 486: score 41.9, E = 1.5e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ L++I +elL++ +l+e+ +
CP001649_3 420 AIGQLAGGVAHDFNNMLSGIFSSVELLRR----------KLPEDPK- 455

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+r+yl+ i ++++r +L lL ++r +
CP001649_3 456 ---------VRKYLDLIFDASKRSADLTHKLLSFARKQPA 486

CP001649_3378: domain 1 of 1, from 354 to 444: score 37.9, E = 2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldk.v.lagdtelseeq
+ + ++a+++HE+++PL+aI g+++ +l++ +k+++ ++t++
CP001649_3 354 SVGGLAAGMAHEINNPLAAIVGNSQNILNRIYKdLdKNHETACECNV 400

rlpeLR..ledpeyreyletilreaerllrLindlLdlsrieag<-*
l R+ l + + ++l+ i ++ +r +++++L +sr +
CP001649_3 401 DLENIReyLSRRDVPKMLNGISESCNRAATIVSNMLRFSRKSER 444

CP001649_2048: domain 1 of 1, from 635 to 725: score 37.8, E = 2.1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL +I a+ + +++ ++l + r+
CP001649_2 635 SVGGLAAGMAHEINNPLGVIAQGAQNITRRV------LGDLKSNRRA 675

peLR...l.......edpeyreyletilreaerllrLindlLdlsrieag
e+R+ +l++ ++ d+ + ++++ i +++r ++++++L +sr +
CP001649_2 676 AEARninLedlhgymHDRDIPKIINGITASVDRAAKIVRNMLSFSRKNQD 725

<-*

CP001649_2 - -

CP001649_1113: domain 1 of 1, from 443 to 514: score 37.5, E = 2.6e-10
*->akseflanlsHELRTPLtaIrg...yaelLleeldkvlagdtelsee
+++e+ a+++HE ++PL+aI+++++y+ l+ e++ + ++
CP001649_1 443 SLGEMSAGVAHEVNQPLNAIKMgseYLALMAEQG-------RDVPAS 482

qrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
q+ +e + + ++++r ++i+ l+ + r
CP001649_1 483 QL-----------QEVAKEVSNQVDRAAEIISALRAFGRKSGF 514

CP001649_1856: domain 1 of 1, from 78 to 150: score 36.2, E = 6.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +e+ a+++HE+++PL+ I+ ae+++ + + +++ l +++
CP001649_1 78 SFDEMSAGIAHEINNPLNIIMQEAEIIRVNIE---FSESCLLTDEI- 120

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e + +i+ +++r+++ + lLd+ r + +
CP001649_1 121 ----------DESIGVIRAQVRRCSEVTRKLLDMGRKRLP 150

CP001649_1877: domain 1 of 1, from 514 to 604: score 36.0, E = 7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL++I+ +++ + + +t + + +
CP001649_1 514 SVGGLAAGMAHEINNPLAGILQAVQNIYR--------RTSPDVPANK 552

peLRl............edpeyreyletilreaerllrLindlLdlsrie
+++ + +++ ++ + e +++ ++l+ i++++er +++ +L ++r
CP001649_1 553 TAAKEvgssceqiqaylEKRGIIKMLDGIHSSGERAANIVHTMLNFTRRN 602

ag<-*
g
CP001649_1 603 DG 604

CP001649_0711: domain 1 of 1, from 553 to 643: score 33.9, E = 2.7e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL I+ ++ + + +t + + ++
CP001649_0 553 SIGGLAAGMAHEINNPLGIIMQVTQNIIR--------RTSPTLKSNI 591

peLR.....l.......edpeyreyletilreaerllrLindlLdlsrie
p + + + +l++ ++ +++ eyl++i++++ r +++ +L++sr
CP001649_0 592 PVAEkcnidLdnlrnymDKRGINEYLRSIQEAGTRAAAIVKSMLEFSRKS 641

ag<-*
+
CP001649_0 642 NS 643

CP001649_3013: domain 1 of 1, from 322 to 381: score 33.8, E = 2.9e-09
*->flanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLR
f+ ++ HE+RTPL++I+g +++L +ls+e
CP001649_3 322 FMQAICHEMRTPLAGIIGSLHVLDH---------MNLSPEA------ 353

ledpeyreyletilreaerllrLindlLdlsrieag<-*
+ey+++ +aer + +n+ ls + +
CP001649_3 354 ------KEYVHKCVVSAERFKDVVNN--SLSDLAGN 381

CP001649_1854: domain 1 of 1, from 324 to 398: score 33.2, E = 4.3e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++++a+++HE ++PL+ Ir a +++ +d+ + l
CP001649_1 324 SLGKMAAGVAHEVNNPLSIIRESAGWIRD-----MISDGGFEGVKDL 365

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p L +e+l i+r +er ++ ++L ++r ++
CP001649_1 366 PNL-------EEALGDIERHVERARSVTHRMLGFARSMEP 398

CP001649_2624: domain 1 of 1, from 519 to 585: score 33.2, E = 4.3e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefl+ + L TPL++I ++++Ll+ d++l+ +
CP001649_2 519 AKSEFLSRMGLKLSTPLNTIVDFSDALLR--------DDDLTGKM-- 555

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++ i +++++l ++i+++Ld+s e++
CP001649_2 556 ----------RSDVDNIASAGHHLKEIISEVLDFSMVESE 585

CP001649_3105: domain 1 of 1, from 245 to 311: score 32.1, E = 8.7e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e+ + ++H+LR P + I g++ +L++ ++ l+ee
CP001649_3 245 LREEMERIARHDLRSPTANIVGMSRILET--------EAGLDEEF-- 281

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + e++++ +er+ r+i+ L+l r+e+g
CP001649_3 282 ----------QPLAEIVRKTSERMIRQIDTSLTLIRLETG 311

CP001649_0492: domain 1 of 1, from 327 to 387: score 31.8, E = 1e-08
*->lsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledp
++H+L+ PL++I+g+ +lLl+ + +l+e q
CP001649_0 327 MRHDLKVPLNGIIGLPDLLLN------DDEVNLTESQ---------- 357

eyreyletilreaerllrLindlLdlsrieag<-*
re le i+ ++ ll++in Ldl ++e+g
CP001649_0 358 --REVLEYIKISGYKLLNMINLSLDLYKMETG 387

CP001649_1357: domain 1 of 1, from 521 to 588: score 31.8, E = 1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++++++HEL++PL+ +++ + lL +++ +++ + +
CP001649_1 521 TLGEMASGVAHELNQPLAILKTISNLLMRKV--------TRNQQVEP 559

peLRledpeyreyletilreaerllrLindlLdlsr<-*
+ L +e+ e ++ ++r +++i+ ++++ r
CP001649_1 560 KVL-------KEMAEGVDTHVNRASKIIEHMREFGR 588

CP001649_1429: domain 1 of 2, from 518 to 563: score 31.5, E = 1.3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL+aI g+++ L++ l++e
CP001649_1 518 SVGGLAAGMAHEINNPLAAIVGAVQNLQK----------RLGSES-- 552

peLRledpeyreyletilrea<-*
++ + ++++++
CP001649_1 553 ----------KKNILVAEECG 563

CP001649_2182: domain 1 of 1, from 338 to 411: score 31.5, E = 1.3e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +e++a+++HE+++P++ ++ a ++ l+ +++e ++ +
CP001649_2 338 SIGELAAGIAHEINNPVAIMIEEAGWVQDLLE---DEEGEITSYT-- 379

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ ++le ++ ++ r+ ++ lL ++r
CP001649_2 380 --------EISRALEQVRTQGGRCKDITHKLLSFARQTDS 411

CP001649_0340: domain 1 of 1, from 529 to 600: score 30.8, E = 2.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++ +++HEL++PL++++ +a + +++l + + +r
CP001649_0 529 TLGEMATGVAHELNQPLATLQIAANIFKRKL-------KKNAPIERE 568

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + +i + + r ++in ++++ r +
CP001649_0 569 TL--------ENMSAKISNNVGRATKIINHMREFGRKANI 600

CP001649_3659: domain 1 of 1, from 591 to 681: score 30.7, E = 2.2e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+++HE+++PL +I+ ++ ++++l ++ + ++
CP001649_3 591 SVGGLAAGMAHEINNPLGGILQGTQNIERRL------RPGMAKNEQ- 630

peLR.l...........edpeyreyletilreaerllrLindlLdlsrie
+R+l+ + ++ ++ e +++ ++l+ ++++a r +i+++L +sr
CP001649_3 631 -VARkLdisletvndylEERGILKILSGVRQSATRAAGIISNMLNFSRKT 679

ag<-*

CP001649_3 680 DV 681

CP001649_1124: domain 1 of 1, from 350 to 418: score 28.9, E = 6.9e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++a+++HE+++PL+ I a lL++ ++ + + ++++r
CP001649_1 350 SIGRLAAGVAHEINNPLAIINEKAGLLKD----LFTFSKAYDADERV 392

peLRledpeyreyletilreaerllrLindlLdlsr<-*
L +++++ ++er+ r+ +lL +sr
CP001649_1 393 IGL----------VDSVIGSVERCGRITKRLLGFSR 418

CP001649_3660: domain 1 of 1, from 252 to 317: score 28.1, E = 1.2e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + + +H+L+TPL+a++ +lL + +e ++e++
CP001649_3 252 LRVDVERITRHDLKTPLNAVINIPHLLIA---------DESDPEKI- 288

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+++ i++++ r+l L+n+ d+ r+e+
CP001649_3 289 -----------ELIKNIQDAGYRMLGLVNRSYDIYRMETD 317

CP001649_1443: domain 1 of 1, from 171 to 237: score 27.9, E = 1.3e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +++ +++H++R+ +I g++ l+ ++l ++ se
CP001649_1 171 SLAQMAKSVAHQIRNRTMTINGFTNLASRKL-------GPHSEAS-- 208

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
eyleti +e+ rl++++n + +++ i+
CP001649_1 209 -----------EYLETISHETARLEDIVNSVSEFAAIDRC 237

CP001649_3126: domain 1 of 1, from 472 to 562: score 27.8, E = 1.4e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldk........v.lagd
+ + ++a+++HE+++PL +I a+ L++ + +++ + + ++a +
CP001649_3 472 SIGGLAAGMAHEINNPLGGIVQGAQNLER---RfspeikanAdAADE 515

telseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<
+ +s + ++++L e + + ++ i++++ r ++++++L +s+ + +
CP001649_3 516 AGCSLDAMQGYL--EARKINSVIKGIKDSGMRAAKIVSNMLKFSKPGKN 562

-*

CP001649_3 - -

CP001649_0543: domain 1 of 2, from 205 to 229: score 27.5, E = 1.8e-07
*->akseflanlsHELRTPLtaIrgyae<-*
+++ ++a+++HE+++PL+aI+g+++
CP001649_0 205 SLGAMAAGIAHEINNPLSAILGACQ 229

CP001649_0360: domain 1 of 1, from 147 to 210: score 27.1, E = 2.3e-07
*->nlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRled
+++HE+++PL+aIr+++ +l la ++e +++++
CP001649_0 147 GIAHEINQPLNAIRLLSASALL-----LADRSENPDKKI-------- 180

peyreyletilreaerllrLindlLdlsrieag<-*
++l+ i +++r+++++n l++ r +
CP001649_0 181 ---VRILQNIAGQVDRIDSIVNHLREHLRNNQT 210


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 3 0|=
-14 7 0|=
-13 38 2|*==
-12 148 87|======*====
-11 423 451|=============================== *
-10 669 837|================================================ *
-9 771 864|======================================================== *
-8 589 647|=========================================== *
-7 424 407|=============================*=
-6 273 234|================*===
-5 162 128|=========*==
-4 86 68|====*==
-3 58 36|==*==
-2 36 19|=*=
-1 20 9|*=
0 11 5|*
1 5 2|*
2 5 1|*
3 1 0|=
> 4 78 -|======


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 157.5833
P(chi-square) = 1.631e-27

Total sequences searched: 3807

Whole sequence top hits:
tophits_s report:
Total hits: 64
Satisfying E cutoff: 64
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 61
Satisfying E cutoff: 61
Total memory: 45K


Acknowledgements:

This research is funded by:

Developed by: