Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Dickeya zeae Ech1591  

Data for CP001655  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001655.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001655_1850 CDS_2162896-2164536 84.4 1.4e-24 1
CP001655_1806 CDS_2113280-2111469 78.7 6.9e-23 1
CP001655_3420 CDS_3982234-3980717 56.3 2.7e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001655_1850 1/1 348 415 .. 1 70 [] 84.4 1.4e-24
CP001655_1806 1/1 394 462 .. 1 70 [] 78.7 6.9e-23
CP001655_3420 1/1 304 370 .. 1 70 [] 56.3 2.7e-16

Alignments of top-scoring domains:
CP001655_1850: domain 1 of 1, from 348 to 415: score 84.4, E = 1.4e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IARE+HD++gQ+L+++++ l+l r+++ ++d++ ++l+++
CP001655_1 348 ERKHIAREIHDELGQHLTSMRMSLSLMRMQF--ARDNPHMLTQLQNL 392

relarealaevRrllgdLRpaal<-*
++l++++++ vR+++++LRp +l
CP001655_1 393 MALSDKTIQVVRHVATRLRPNVL 415

CP001655_1806: domain 1 of 1, from 394 to 462: score 78.7, E = 6.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHDs++QsLs +k+q++ ++++ ++ +e++++ld++
CP001655_1 394 ERTTIARELHDSIAQSLSCLKIQVSCLQMQH--TALTPEIQQQLDAM 438

relarealaevRrllgdLR.paal<-*
r+ +++a++++R+ll+++R +
CP001655_1 439 RDEINTAYRQLRELLTTFRlKLSE 462

CP001655_3420: domain 1 of 1, from 304 to 370: score 56.3, E = 2.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
R+ ARELHD +gQ+++ai+ q++ ++ + +pe++ +++ +
CP001655_3 304 VRRDVARELHDDIGQTITAIRTQAGILQ-----RQAPEsrNVQQSSA 345

eirelarealaevRrllgdLRpaal<-*
i++l+ ++ vRrl g+LRp +l
CP001655_3 346 LIEQLSLSVYDSVRRLMGRLRPRQL 370


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 21 0|==
-13 87 0|=======
-12 126 46|===*=====
-11 177 381|============= *
-10 569 885|========================================= *
-9 784 1005|======================================================== *
-8 665 774|================================================ *
-7 564 487|==================================*======
-6 382 275|===================*========
-5 341 147|==========*==============
-4 162 77|=====*======
-3 115 39|==*======
-2 64 20|=*===
-1 41 10|*==
0 29 5|*==
1 20 2|*=
2 7 1|*
3 3 0|=
4 2 0|=
> 5 4 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1256.9679
P(chi-square) = 0

Total sequences searched: 4163

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: