Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Pectobacterium carotovorum subsp. carotovorum PC1  

Data for CP001657  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001657.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001657_2236 CDS_2600187-2601995 81.4 1.1e-23 1
CP001657_2179 CDS_2533829-2532249 79.7 3.5e-23 1
CP001657_2375 CDS_2769404-2767686 77.7 1.3e-22 1
CP001657_1351 CDS_1597342-1595765 61.0 1.1e-17 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001657_2236 1/1 393 461 .. 1 70 [] 81.4 1.1e-23
CP001657_2179 1/1 326 393 .. 1 70 [] 79.7 3.5e-23
CP001657_2375 1/1 360 427 .. 1 70 [] 77.7 1.3e-22
CP001657_1351 1/1 314 379 .. 1 70 [] 61.0 1.1e-17

Alignments of top-scoring domains:
CP001657_2236: domain 1 of 1, from 393 to 461: score 81.4, E = 1.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsLs +k+q++ ++++ + p++ ++ l+e+
CP001657_2 393 ERATIARELHDSIAQSLSCLKIQVSCLQMQG--GDLPPASQQLLTEM 437

relarealaevRrllgdLR.paal<-*
re +++a++++R+ll+++R +
CP001657_2 438 REELNTAYRQLRELLTTFRlKLSE 461

CP001657_2179: domain 1 of 1, from 326 to 393: score 79.7, E = 3.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IA+E+HD++gQ+L+ i++ l+l r+ + +k+++ +++l+ +
CP001657_2 326 ERKHIAQEIHDELGQHLTTIRMSLSLMRMCF--AKENPDMQAHLQKL 370

relarealaevRrllgdLRpaal<-*
++la+++++ vR++ ++LRp +l
CP001657_2 371 MQLADQTIQVVRNVSTRLRPNVL 393

CP001657_2375: domain 1 of 1, from 360 to 427: score 77.7, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++Q Ls +++q+ l++r++ ++++++ar+ ++
CP001657_2 360 ERATIARELHDSLAQVLSYLNIQMTLLKRAV--AEENAQARQIITDF 404

relarealaevRrllgdLRpaal<-*
++++++a++++R+llg++R +
CP001657_2 405 EQALSDAYRQLRELLGTFRLTLQ 427

CP001657_1351: domain 1 of 1, from 314 to 379: score 61.0, E = 1.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARELHD +gQ+++ai +q+ l+++ + ++d +a+ a+ +i
CP001657_1 314 VRKDIARELHDDIGQNITAIQIQAMLVKHSA--PTD--AAQHAAGQI 356

relarealaevRrllgdLRpaal<-*
el+r+ +R+ll++LRp++l
CP001657_1 357 SELSRRIHHTTRQLLRQLRPPVL 379


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 18 0|==
-13 90 0|=======
-12 123 47|===*=====
-11 234 389|================= *
-10 689 902|================================================== *
-9 815 1025|==========================================================*
-8 645 790|=============================================== *
-7 550 496|===================================*====
-6 358 281|====================*=====
-5 311 150|==========*============
-4 187 78|=====*========
-3 89 40|==*====
-2 59 20|=*===
-1 28 10|*=
0 21 5|*=
1 16 2|*=
2 2 1|*
3 3 0|=
4 2 0|=
5 0 0|
6 0 0|
> 7 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 852.3298
P(chi-square) = 0

Total sequences searched: 4246

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: