Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for   

Data for CP001661  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001661.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001661_3045 CDS_3597010-3598467 61.2 9.4e-18 1
CP001661_0459 CDS_572698-575040 53.9 1.4e-15 1
CP001661_1076 CDS_1291797-1292891 33.4 1.5e-09 2
CP001661_1936 CDS_2286207-2284942 32.8 2.3e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001661_3045 1/1 277 344 .. 1 70 [] 61.2 9.4e-18
CP001661_0459 1/1 576 641 .. 1 70 [] 53.9 1.4e-15
CP001661_1936 1/1 214 277 .. 1 70 [] 32.8 2.3e-09
CP001661_1076 1/2 152 176 .. 1 25 [. 30.7 9.6e-09

Alignments of top-scoring domains:
CP001661_3045: domain 1 of 1, from 277 to 344: score 61.2, E = 9.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++++RELHD +gQ+L a+k+++++++ l + p+ ++ +
CP001661_3 277 ERRHLSRELHDDLGQRLNAVKIGVDTLACDL--PQLPPDFLSRVGYL 321

relarealaevRrllgdLRpaal<-*
e+++ +++ vR++ ++LRp+ l
CP001661_3 322 SEILQSTIQSVRDICSGLRPSSL 344

CP001661_0459: domain 1 of 1, from 576 to 641: score 53.9, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA ELHD vgQ+L ++k++l+ ++ l + e ++++ +
CP001661_0 576 ERDRIASELHDQVGQRLILAKIKLDSLASNL--PLG--ECEAEAVGV 618

relarealaevRrllgdLRpaal<-*
++l++++l+++R l ++Rp+ l
CP001661_0 619 ETLIEQTLQDIRSLTFQIRPPLL 641

CP001661_1936: domain 1 of 1, from 214 to 277: score 32.8, E = 2.3e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ELHD v Q+L++ kl l++ ++ d + + r +e+
CP001661_1 214 ERRRIATELHDDVVQHLALCKLRLDMELK----DGA--PSRVLQEEL 254

relarealaevRrllgdLRpaal<-*
+ + ++++++Rr+ dL p++l
CP001661_1 255 VGELVRTMQQIRRICYDLSPPVL 277

CP001661_1076: domain 1 of 2, from 152 to 176: score 30.7, E = 9.6e-09
*->ERaRIARELHDsvgQsLsaiklqle<-*
ER+RIA ELHD++gQ+L+++k+ l+
CP001661_1 152 ERRRIASELHDEIGQTLALAKIRLH 176


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 22 0|==
-13 90 0|=======
-12 128 45|===*======
-11 207 373|=============== *
-10 555 867|======================================== *
-9 806 985|==========================================================*
-8 578 759|========================================== *
-7 511 477|==================================*==
-6 401 270|===================*=========
-5 350 144|==========*==============
-4 154 75|=====*=====
-3 107 38|==*=====
-2 69 19|=*===
-1 38 10|*==
0 22 5|*=
1 14 2|*
2 11 1|*
3 6 0|=
4 4 0|=
5 0 0|
6 1 0|=
7 1 0|=
> 8 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1221.7351
P(chi-square) = 0

Total sequences searched: 4080

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: