Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

1 accessions found for Methylotenera mobilis JLW8  

Data for CP001672  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001672.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001672_1063 CDS_1164544-1165899 62.1 3e-18 1
CP001672_0906 CDS_988758-990257 53.0 1.4e-15 1
CP001672_1369 CDS_1507928-1506558 45.7 2e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001672_1063 1/1 251 316 .. 1 70 [] 62.1 3e-18
CP001672_0906 1/1 302 369 .. 1 70 [] 53.0 1.4e-15
CP001672_1369 1/1 242 314 .. 1 70 [] 45.7 2e-13

Alignments of top-scoring domains:
CP001672_1063: domain 1 of 1, from 251 to 316: score 62.1, E = 3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IA +LHD++gQ+L+ai++ ++++++ + d e +++i
CP001672_1 251 ERKNIAHDLHDEIGQHLTAINIDASAILK----ANDLTSTYESAQAI 293

relarealaevRrllgdLRpaal<-*
ar+ ++ vR++l++LRpa+l
CP001672_1 294 SIVARQMMEIVRQMLQRLRPAVL 316

CP001672_0906: domain 1 of 1, from 302 to 369: score 53.0, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g +L+aik++l + ++ ++ + e+++ +
CP001672_0 302 ERTRIAREIHDDLGGNLTAIKIGLTSIINRI--ATGLPVSFEQAKGL 346

relarealaevRrllgdLRpaal<-*
+ +++ + + + + +dLRp +l
CP001672_0 347 ESIVDNTFEAIHKISSDLRPNIL 369

CP001672_1369: domain 1 of 1, from 242 to 314: score 45.7, E = 2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER+ +ARELHD++gQ +aik + ++ + +++ + + +e++
CP001672_1 242 ERRSLARELHDELGQYVTAIKTFAVSIANKA--KANSSgagmtEIAS 286

aldeirelarealaevRrllgdLRpaal<-*
++ i +a++ ++ + +++++LRp+al
CP001672_1 287 SAQVIVSAANQIYDGMHNIVRQLRPGAL 314


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 15 0|==
-13 50 0|=======
-12 87 26|===*=======
-11 194 214|========================= *
-10 414 497|==================================================== *
-9 459 564|==========================================================*
-8 331 435|========================================== *
-7 277 273|==================================*
-6 203 154|===================*======
-5 137 83|==========*=======
-4 61 43|=====*==
-3 45 22|==*===
-2 30 11|=*==
-1 16 5|*=
0 6 2|*
1 3 1|*
2 4 0|=
> 3 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 331.1620
P(chi-square) = 0

Total sequences searched: 2338

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: