Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

1 accessions found for Flavobacteriaceae bacterium 3519-10  

Data for CP001673  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001673.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001673_1107 CDS_1213812-1215770 60.2 1.2e-17 1
CP001673_0935 CDS_997957-999327 41.3 4.2e-12 1
CP001673_1298 CDS_1439085-1440929 33.3 1e-09 1
CP001673_0874 CDS_935238-934474 31.1 4.5e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001673_1107 1/1 452 519 .. 1 70 [] 60.2 1.2e-17
CP001673_0935 1/1 258 323 .. 1 70 [] 41.3 4.2e-12
CP001673_1298 1/1 414 480 .. 1 70 [] 33.3 1e-09
CP001673_0874 1/1 58 123 .. 1 70 [] 31.1 4.5e-09

Alignments of top-scoring domains:
CP001673_1107: domain 1 of 1, from 452 to 519: score 60.2, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI RELHDs+g Ls++ l +++++++ + + e+ e l +
CP001673_1 452 ERKRIGRELHDSLGYLLSLAGLNASVLQKRK--ELPEEKKSELLNSL 496

relarealaevRrllgdLRpaal<-*
+e +++a +evR + ++L p+ l
CP001673_1 497 MESINDAFDEVRTISHNLAPSLL 519

CP001673_0935: domain 1 of 1, from 258 to 323: score 41.3, E = 4.2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A ELHD+++ L+aik l+++++ ++ +e + e+
CP001673_0 258 ERKRLAEELHDGIAGDLAAIKFNLHALKTNH--RSS--GDEELIGEL 300

relarealaevRrllgdLRpaal<-*
++++++ ++R++ ++L p++
CP001673_0 301 TQIIDRSCVQIREISHNLSPSTV 323

CP001673_1298: domain 1 of 1, from 414 to 480: score 33.3, E = 1e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A LHD++gQ L+a+++ ++++ ++++d + ++ l +
CP001673_1 414 ERKRMATHLHDGIGQLLAAANMNISVLD---EYKSDENAFEKILVRT 457

relarealaevRrllgdLRpaal<-*
r ++ ea+a++R l +++ p +l
CP001673_1 458 RSILAEAIADARTLSHQIMPNIL 480

CP001673_0874: domain 1 of 1, from 58 to 123: score 31.1, E = 4.5e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRI+ ELHD+v +L +i++ ++++ +l +++ e+ + ei
CP001673_0 58 ERARISSELHDTVIGNLVSISIYFGMLKNRL--KDP--EVLGVISEI 100

relarealaevRrllgdLRpaal<-*
e ++++ + +R++ +L p+ l
CP001673_0 101 DEELKDTKQLIRQITYNLMPPLL 123


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-15 1 0|=
-14 57 0|=======
-13 127 0|===============
-12 179 28|===*================
-11 243 232|=========================*=
-10 510 538|========================================================= *
-9 515 611|==========================================================*
-8 359 471|======================================== *
-7 233 296|========================== *
-6 127 167|=============== *
-5 96 90|=========*=
-4 38 46|=====*
-3 15 24|==*
-2 13 12|=*
-1 7 6|*
0 3 3|*
1 3 1|*
2 0 0|
> 3 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 875.8521
P(chi-square) = 0

Total sequences searched: 2534

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: