Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

3 accessions found for Methylovorus sp. SIP3-4  

Data for CP001674  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001674.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001674_0728 CDS_765800-767152 68.1 6e-20 1
CP001674_0744 CDS_780359-781756 67.3 1e-19 1
CP001674_2453 CDS_2594457-2592631 60.5 1.1e-17 1
CP001674_0732 CDS_769940-768600 55.2 3.8e-16 1
CP001674_1124 CDS_1200872-1202284 48.8 3e-14 1
CP001674_1564 CDS_1677875-1676157 45.6 2.5e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001674_0728 1/1 246 312 .. 1 70 [] 68.1 6e-20
CP001674_0744 1/1 266 333 .. 1 70 [] 67.3 1e-19
CP001674_2453 1/1 408 476 .. 1 70 [] 60.5 1.1e-17
CP001674_0732 1/1 244 310 .. 1 70 [] 55.2 3.8e-16
CP001674_1124 1/1 269 336 .. 1 70 [] 48.8 3e-14
CP001674_1564 1/1 369 436 .. 1 70 [] 45.6 2.5e-13

Alignments of top-scoring domains:
CP001674_0728: domain 1 of 1, from 246 to 312: score 68.1, E = 6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+++AR+LHD++gQsL+ai+ + ++ d+ +++++e +++i
CP001674_0 246 ERKHLARDLHDEIGQSLTAINADATAI-VNS--DSSNPRIKESAAAI 289

relarealaevRrllgdLRpaal<-*
+ ar+ + vR++l +LRp++l
CP001674_0 290 VQVARHVVTIVRDMLEHLRPDTL 312

CP001674_0744: domain 1 of 1, from 266 to 333: score 67.3, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +g +L+aik++l + +++ d +++ e + ++
CP001674_0 266 ERRRIAREIHDDLGGNLTAIKIGLTSIIKRI--NPDEPKLVEKALNL 310

relarealaevRrllgdLRpaal<-*
+ +++++ + v r+++dLRp++l
CP001674_0 311 ESIVDRTFDIVHRIASDLRPDVL 333

CP001674_2453: domain 1 of 1, from 408 to 476: score 60.5, E = 1.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARELHDs++QsLs +k+q+ +++ + ++ + +r + e+
CP001674_2 408 ERAAIARELHDSLAQSLSFMKIQIFRLQSHP--QTQHADLRGIVNEL 452

relarealaevRrllgdLR.paal<-*
r+ ++ a++e+R+ll+++R +++
CP001674_2 453 RQGLDNAYRELRELLSTFRvHMDV 476

CP001674_0732: domain 1 of 1, from 244 to 310: score 55.2, E = 3.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IAR+LHD gQ L aik + + + ++ p+ + e + i
CP001674_0 244 ERRHIARDLHDDMGQYLNAIKANATSL-VNM--PDLPPSISEVALHI 287

relarealaevRrllgdLRpaal<-*
++++ ++ +R+l+++LRpaal
CP001674_0 288 ISHSDHIYRSARQLIHRLRPAAL 310

CP001674_1124: domain 1 of 1, from 269 to 336: score 48.8, E = 3e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++g L+a k+ ++++ r + ++ + +++ l+
CP001674_1 269 EREKLARELHDELGSILTATKMDISWVTRKT--RDTFPDVADKLAKT 313

relarealaevRrllgdLRpaal<-*
++ ++++++ R++++dL+p+ l
CP001674_1 314 MRYIDQGIQFKRQVVQDLHPSML 336

CP001674_1564: domain 1 of 1, from 369 to 436: score 45.6, E = 2.5e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++gQ +aik + ++ + +++ + +++ +++i
CP001674_1 369 ERRSLARELHDELGQYVTAIKTFAVGISNKT--TEAMPDIAANAQTI 413

relarealaevRrllgdLRpaal<-*
++a++ ++ + +++++LRp+ l
CP001674_1 414 VAAANHIYDGMHNIIRQLRPGSL 436


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 25 0|===
-13 76 0|=========
-12 92 31|===*=======
-11 170 258|=================== *
-10 439 599|================================================= *
-9 481 680|====================================================== *
-8 436 524|================================================= *
-7 372 329|====================================*=====
-6 266 186|====================*=========
-5 186 100|===========*=========
-4 108 52|=====*======
-3 60 26|==*====
-2 29 13|=*==
-1 27 6|*==
0 16 3|*=
1 9 1|*
2 7 0|=
3 6 0|=
4 4 0|=
5 1 0|=
> 6 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 550.3160
P(chi-square) = 0

Total sequences searched: 2818

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: