Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

2 accessions found for Hirschia baltica ATCC 49814  

Data for CP001678  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001678.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001678_2016 CDS_2187053-2188753 114.7 1.5e-32 1
CP001678_1339 CDS_1415692-1416792 64.3 3.1e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001678_2016 1/1 367 455 .. 1 94 [] 114.7 1.5e-32
CP001678_1339 1/1 172 246 .. 1 81 [. 64.3 3.1e-18

Alignments of top-scoring domains:
CP001678_2016: domain 1 of 1, from 367 to 455: score 114.7, E = 1.5e-32
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+++S L+LQ+r++k+ + +eaL+ +++R+ +
CP001678_2 367 EIHHRVKNNLQIVTSYLNLQSRQVKENSA-----KEALKAARHRIDA 408

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++H+ LY++e l++vd+ ++l+ L+++L ++ g ++ + D+
CP001678_2 409 LSIVHQTLYQNERLSDVDLHPFLTGLISHLQEALGANTANVTITSDI 455

CP001678_1339: domain 1 of 1, from 172 to 246: score 64.3, E = 3.1e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKN+LQ+++SL+rL k +e ea+ + V +
CP001678_1 172 EMDHRVKNSLQTVASLVRLYKSKG-HPES-----AEAFDAVARKVEA 212

mAliHEeLYksedldtvdfseYlekLtenLfqsy<-*
++l+HEeL+++ + + v ++ +++k+++ L +s+
CP001678_1 213 ISLLHEELHQTTSNEMVPMKRFIQKVVDLLQKSA 246


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-15 3 0|=
-14 13 0|=
-13 30 19|=*=
-12 134 204|=========== *
-11 766 570|===========================================*===============
-10 700 738|====================================================== *
-9 566 623|============================================ *
-8 431 418|================================*=
-7 207 248|================ *
-6 153 138|==========*=
-5 63 74|=====*
-4 24 39|==*
-3 10 20|=*
-2 6 10|*
-1 5 5|*
0 3 2|*
> 1 5 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 128.8797
P(chi-square) = 1.036e-21

Total sequences searched: 3119

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: