Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Kytococcus sedentarius DSM 20547  

Data for CP001686  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001686.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001686_0092 CDS_103569-102451 85.2 5.1e-25 1
CP001686_2238 CDS_2454642-2453428 84.7 6.8e-25 2
CP001686_1629 CDS_1777420-1776071 79.8 1.9e-23 1
CP001686_0586 CDS_614813-616129 71.3 6.4e-21 1
CP001686_0422 CDS_443364-444773 66.2 2.1e-19 1
CP001686_0265 CDS_279675-278449 60.7 8.5e-18 1
CP001686_0379 CDS_392178-390973 57.2 9.1e-17 1
CP001686_1671 CDS_1832347-1831367 54.5 5.5e-16 1
CP001686_0680 CDS_721855-722568 46.2 1.6e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001686_0092 1/1 188 255 .. 1 70 [] 85.2 5.1e-25
CP001686_2238 1/2 199 266 .. 1 70 [] 83.1 2.1e-24
CP001686_1629 1/1 216 283 .. 1 70 [] 79.8 1.9e-23
CP001686_0586 1/1 239 306 .. 1 70 [] 71.3 6.4e-21
CP001686_0422 1/1 197 284 .. 1 70 [] 66.2 2.1e-19
CP001686_0265 1/1 213 282 .. 1 70 [] 60.7 8.5e-18
CP001686_0379 1/1 194 254 .. 1 70 [] 57.2 9.1e-17
CP001686_1671 1/1 134 200 .. 1 70 [] 54.5 5.5e-16
CP001686_0680 1/1 37 105 .. 1 70 [] 46.2 1.6e-13

Alignments of top-scoring domains:
CP001686_0092: domain 1 of 1, from 188 to 255: score 85.2, E = 5.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R AR+ HD++g+sL+ai l+++la+rl+ +d+++ar+++ ++
CP001686_0 188 ERERVARDVHDVLGHSLTAIVLKADLAERLV--GRDDDRARDEISQV 232

relarealaevRrllgdLRpaal<-*
++lar+al+e+R ++ +LR a+l
CP001686_0 233 AALARQALSEARSTVVGLRSADL 255

CP001686_2238: domain 1 of 2, from 199 to 266: score 83.1, E = 2.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++g+sL i++q+e++r+++ ++dp++ ++ l+ i
CP001686_2 199 ERTRIAREMHDVLGHSLNTIAIQAEGVRYVV--RTDPQRTDQVLADI 243

relarealaevRrllgdLRpaal<-*
+l+r+a ++vR+l+++L ++++
CP001686_2 244 GRLSRTAVDDVRDLISVLATDDE 266

CP001686_1629: domain 1 of 1, from 216 to 283: score 79.8, E = 1.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARE+HD +g++Ls++++++++++++ d +++e+r+a+ +i
CP001686_1 216 ERAAIAREMHDALGHRLSVVSMHAGALAYRQ--DMPADEVRQAAGTI 260

relarealaevRrllgdLRpaal<-*
++ ar+al+++R++lg+LR ++
CP001686_1 261 AGQARTALEDLREILGVLRSTDA 283

CP001686_0586: domain 1 of 1, from 239 to 306: score 71.3, E = 6.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE HD++g++Ls++++++++++ ++ + +ee+ + ++ +
CP001686_0 239 ERERIAREVHDTLGHRLSLLSVHAGALELQA--EGRDEEVSRSAALV 283

relarealaevRrllgdLRpaal<-*
r+ ar+a++++R l+g LR++ +
CP001686_0 284 RQGARQAMDDLRSLVGILREDPD 306

CP001686_0422: domain 1 of 1, from 197 to 284: score 66.2, E = 2.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ERa IARE+HD +++sLs++++q+++ r+++ ++ +++ +++
CP001686_0 197 ERAAIAREMHDIIAHSLSVVIVQADGGRYAA--RAGTTaadhglege 241

...........earealdeirelarealaevRrllgdLRpaal<-*
+ ++ +++ + a++al++i+++areal e+Rrl+g+LR+++
CP001686_0 242 dlqraqegalkGAQDALEQIATTAREALGETRRLVGVLRDPGK 284

CP001686_0265: domain 1 of 1, from 213 to 282: score 60.7, E = 8.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD+ g +Ls+++l++el + l++ + eea++++d +
CP001686_0 213 ERLRFSRDLHDTFGRTLSVVSLKAELGAELAR-RGRTEEAAAEMDGV 258

relarealaevRrllgdLR.paal<-*
r+ +e+ aevRr+++++R+ +
CP001686_0 259 RQVTQEGAAEVRRVVSGYRnLDPA 282

CP001686_0379: domain 1 of 1, from 194 to 254: score 57.2, E = 9.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v Qs++++ l + + + +e l +i
CP001686_0 194 ERHRIARDLHDTVVQSFTSVLLLARAGG----------RPEEVLPRI 230

relarealaevRrllgdLR.paal<-*
+e a ++lae Rr++++LR++++
CP001686_0 231 EEVAADGLAESRRVVQTLRrEPGR 254

CP001686_1671: domain 1 of 1, from 134 to 200: score 54.5, E = 5.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L+a+ + l++ r++ d + + + + +d++
CP001686_1 134 ERRRIERDLHDGAQQRLTALVMTLGTMRYQHD-RGH--DVTDLIDQA 177

relarealaevRrllgdLRpaal<-*
+ ar+a +e+R++++d+ paal
CP001686_1 178 GHDARRAVEELRQIVHDIFPAAL 200

CP001686_0680: domain 1 of 1, from 37 to 105: score 46.2, E = 1.6e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RI R+LHD+ Q + a+++ l+ ar l ++ ++e+++ l++
CP001686_0 37 ERQRIERDLHDGAQQYMVAAAMLLGEARLLP--AAQQDpELQDMLAR 81

irelarealaevRrllgdLRpaal<-*
+ e ++ +l+ +R ++++++pa+l
CP001686_0 82 AGEQLSSGLDALRSTVRGIHPATL 105


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 7 0|=
-13 22 0|====
-12 49 28|===*===
-11 75 234|=========== *
-10 220 543|================================ *
-9 397 616|========================================================= *
-8 368 475|===================================================== *
-7 363 298|==========================================*=========
-6 305 169|========================*===================
-5 324 90|============*==================================
-4 131 47|======*============
-3 116 24|===*=============
-2 57 12|=*=======
-1 48 6|*======
0 19 3|*==
1 17 1|*==
2 5 0|=
3 10 0|==
4 8 0|==
5 2 0|=
> 6 11 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2066.3198
P(chi-square) = 0

Total sequences searched: 2554

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: