Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

1 accessions found for Chitinophaga pinensis DSM 2588  

Data for CP001699  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001699.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001699_4181 CDS_5297580-5299895 126.5 1.5e-35 1
CP001699_4776 CDS_6065665-6067923 123.9 8e-35 1
CP001699_3418 CDS_4318230-4315789 119.3 1.7e-33 1
CP001699_4302 CDS_5426188-5428611 112.0 2e-31 1
CP001699_4777 CDS_6068093-6070333 110.6 4.8e-31 1
CP001699_4247 CDS_5369254-5367035 105.7 1.3e-29 1
CP001699_2678 CDS_3307021-3309591 103.6 4.9e-29 1
CP001699_0112 CDS_145667-143343 100.9 2.8e-28 1
CP001699_5592 CDS_7242951-7240708 98.5 1.3e-27 1
CP001699_5761 CDS_7435985-7434672 89.3 5.6e-25 1
CP001699_2189 CDS_2725708-2726526 87.3 2e-24 1
CP001699_0113 CDS_148133-145860 86.6 3.3e-24 1
CP001699_2070 CDS_2554627-2552357 81.6 9e-23 1
CP001699_5972 CDS_7668921-7666942 67.0 1.3e-18 1
CP001699_0110 CDS_142937-140841 66.7 1.5e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001699_4181 1/1 556 644 .. 1 94 [] 126.5 1.5e-35
CP001699_4776 1/1 546 633 .. 1 94 [] 123.9 8e-35
CP001699_3418 1/1 606 686 .. 1 94 [] 119.3 1.7e-33
CP001699_4302 1/1 606 690 .. 1 94 [] 112.0 2e-31
CP001699_4777 1/1 541 626 .. 1 94 [] 110.6 4.8e-31
CP001699_4247 1/1 549 634 .. 1 94 [] 105.7 1.3e-29
CP001699_2678 1/1 648 732 .. 1 94 [] 103.6 4.9e-29
CP001699_0112 1/1 563 648 .. 1 94 [] 100.9 2.8e-28
CP001699_5592 1/1 552 639 .. 1 94 [] 98.5 1.3e-27
CP001699_5761 1/1 224 296 .. 1 78 [. 89.3 5.6e-25
CP001699_2189 1/1 73 158 .. 1 94 [] 87.3 2e-24
CP001699_0113 1/1 563 648 .. 1 94 [] 86.6 3.3e-24
CP001699_2070 1/1 566 653 .. 1 94 [] 81.6 9e-23
CP001699_5972 1/1 465 549 .. 1 94 [] 67.0 1.3e-18
CP001699_0110 1/1 489 574 .. 1 94 [] 66.7 1.5e-18

Alignments of top-scoring domains:
CP001699_4181: domain 1 of 1, from 556 to 644: score 126.5, E = 1.5e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HRVKNNLQ++ SLL+ Q++++k+e++ +ea EsqnRV +
CP001699_4 556 EVNHRVKNNLQIVMSLLDTQSEYVKNEKA-----QEAILESQNRVHA 597

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliH++LYk++++ +++s Y++kL+++L +s +++ +++ + +++
CP001699_4 598 IALIHDQLYKTDNTTEINLSLYIKKLVHSLNSSLNHSMNKVAITCEI 644

CP001699_4776: domain 1 of 1, from 546 to 633: score 123.9, E = 8e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+SLL+ Q+++ ++++ l+a r sq+R S
CP001699_4 546 EIHHRVKNNLQIIISLLNTQSQYLNNKDA-----LAAIRNSQQRMYS 587

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY++++l+++d+ Y+ ++++++++s++ +++ is+k+D+
CP001699_4 588 MSLIHQRLYQTDNLGKIDMHWYIPEMIGYMKDSFETEKK-ISFKVDC 633

CP001699_3418: domain 1 of 1, from 606 to 686: score 119.3, E = 1.7e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I SLL Q+ + ++e+ l a +EsqnR+ +
CP001699_3 606 EVHHRVKNNLQTIVSLLESQSAYLQNEA------LLAIQESQNRIYA 646

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY e++++v+++ Yl +L+ +L+ sy+v+++ +
CP001699_3 647 MSLIHQKLYHDENVSSVNMGVYLPELVQYLRLSYNVKNN-------V 686

CP001699_4302: domain 1 of 1, from 606 to 690: score 112.0, E = 2e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+I SLL +Qa++ d + l+a + sqnR+ +
CP001699_4 606 EVHHRVKNNLQTIVSLLEMQADYLGDDA------LAAVQVSQNRIFA 646

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+l+H++LY+ e++++v+++ Yl +L+ +L++++ vg++ i++ +
CP001699_4 647 TSLLHQKLYQFENVSSVNMKNYLPELIQHLREAFPVGKS-IDIQ--M 690

CP001699_4777: domain 1 of 1, from 541 to 626: score 110.6, E = 4.8e-31
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+SLL+ Q+++ +e++ l+a r sq+R S
CP001699_4 541 EIHHRVKNNLQIIISLLNTQSQYLNNEDA-----LAAIRNSQQRMYS 582

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY++e+l+++d+ Y+ +++ ++++s + + +i +k +
CP001699_4 583 MSLIHQRLYQTENLGKIDMNWYIPEMITYIRDSL-DTNAHITFK--V 626

CP001699_4247: domain 1 of 1, from 549 to 634: score 105.7, E = 1.3e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNN ++ +LL Qa + +ee+ + a Esq+R+++
CP001699_4 549 EIHHRVKNNFHMVMGLLHTQAAYLHGEEA-----RQAITESQQRIRA 590

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l+H++LY+sedl+ +++ eY+ +L++ L++s g+ i+++ l
CP001699_4 591 MSLVHQRLYQSEDLSAINMVEYIHELIDCLKDSLHTGRA-IQFN--L 634

CP001699_2678: domain 1 of 1, from 648 to 732: score 103.6, E = 4.9e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I SLL+ Q+ ++ ++ +ea + s nRV+S
CP001699_2 648 EIHHRVKNNLQIIMSLLNSQSAHLRNSDA-----IEAIMVSGNRVRS 689

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliH++LY +++l+++++ eY+ L++++++ + + +++
CP001699_2 690 IALIHQKLYSGDNLSSINMPEYVADLLRYMMDGFDTSERKVR----F 732

CP001699_0112: domain 1 of 1, from 563 to 648: score 100.9, E = 2.8e-28
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++ SLL+ Qa +d+++ l+a rEs+ R ++
CP001699_0 563 EIHHRVKNNLQIVMSLLNTQAAFLDDKDA-----LNAIRESRFRMQA 604

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++liH +LY+se++ +d+ Y+ +L++ L + +++ s +++D+
CP001699_0 605 ISLIHHKLYQSENMALIDINVYIHELIHFLQDGFTGASR---IRFDM 648

CP001699_5592: domain 1 of 1, from 552 to 639: score 98.5, E = 1.3e-27
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+ SLL+ Q+ + +e++ + a ++sq R +S
CP001699_5 552 EIHHRVKNNLQLTMSLLNTQSKYLHNEAA-----IRAINDSQYRLKS 593

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++iH++LY++e+ +++++++Y+ +++e+L++s++ g ++i++ lD+
CP001699_5 594 ISMIHQKLYQGEEEGQINIKAYICEMLEYLKDSFSSG-ERIRFHLDV 639

CP001699_5761: domain 1 of 1, from 224 to 296: score 89.3, E = 5.6e-25
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++ SLL+ Qa ++ + l a r+s+ R ++
CP001699_5 224 EIHHRVKNNLQIVVSLLNTQAAHMEEGSA-----LTAIRDSRLRMQA 265

mAliHEeLYksedldtvdfseYlekLtenLf<-*
+Al+H++LY+ e+ + +d+ Y+++L++nL+
CP001699_5 266 IALLHQKLYQVENAGLIDMPCYINELVGNLR 296

CP001699_2189: domain 1 of 1, from 73 to 158: score 87.3, E = 2e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNLQ+ +SLL+ Q d e+ + a r +q+R +
CP001699_2 73 ETHHRVKNNLQMAISLLNTQYTFLADNEA-----RQAVRNTQHRMFA 114

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++l++++LY+ + l+t+d+ +Y+++L+++L++ y+v +d i+++ l
CP001699_2 115 ISLVYQKLYQEDALSTIDIPQYISELLDYLKDEYEVAAD-IDFN--L 158

CP001699_0113: domain 1 of 1, from 563 to 648: score 86.6, E = 3.3e-24
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRV+NNLQ++ SLL+ Qa + + ++ lea Es+ R ++
CP001699_0 563 EIHHRVRNNLQIVMSLLNTQAAYLHNSDA-----LEAISESRYRMQA 604

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++liH++LY s ++ +d+ Y ++L++ L++ +g+ + L +D+
CP001699_0 605 ISLIHQKLYLSANMALIDMQNYTRELIAGLKDNFGGLQQ---LYFDI 648

CP001699_2070: domain 1 of 1, from 566 to 653: score 81.6, E = 9e-23
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNL +I LL Qar + +e+ ++aL+ s +R+ +
CP001699_2 566 EVHHRVKNNLHTIFCLLESQARTA-TPEA-----RNALEKSTHRIYA 606

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+l H++ Y+s+++ +vdf+ Y+++ + L + + ++ +i++ ++
CP001699_2 607 MSLFHQKVYQSGNIQQVDFGNYMREFLLFLQEGFDLETRNIRVTHEM 653

CP001699_5972: domain 1 of 1, from 465 to 549: score 67.0, E = 1.3e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsq.nRVl
E +HRVKNNLQ+IS + +LQ+ +++++ aL E+ ++RV+
CP001699_5 465 ELNHRVKNNLQIISDIMNLQTATVDSPK------ERALIEAGkSRVQ 505

SmAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-
S++++H+ LY+ ++++++ ++++++++n ++ + + s +
CP001699_5 506 SISIVHNLLYRQAYTGNINMQAFISEIVKNVELAFHGHGRQAS----V 549

*

CP001699_5 - -

CP001699_0110: domain 1 of 1, from 489 to 574: score 66.7, E = 1.5e-18
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR K NLQ+I LL+ Qa +++d+ + ++a rEs++ ++
CP001699_0 489 EIHHRAKDNLQIIVRLLNTQAANVDDQSA-----RAAIRESRHCMQA 530

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
++liH++LY+ ++ +d++ Y+++L+++ ++s+ + + +++Dl
CP001699_0 531 VSLIHQKLYQEDNAAELDMDIYIRELVAYFRDSFDGLHQ---ISFDL 574


Histogram of all scores:
score obs exp (one = represents 27 sequences)
----- --- ---
-15 13 0|=
-14 33 0|==
-13 92 45|=*==
-12 322 472|============ *
-11 1574 1315|================================================*==========
-10 1493 1702|======================================================== *
-9 1335 1437|================================================== *
-8 932 964|===================================*
-7 540 572|==================== *
-6 442 319|===========*=====
-5 195 171|======*=
-4 106 91|===*
-3 54 47|=*
-2 19 24|*
-1 17 12|*
0 4 6|*
1 3 3|*
2 0 1|*
3 1 0|=
> 4 17 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 240.1804
P(chi-square) = 2.918e-314

Total sequences searched: 7192

Whole sequence top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 27K


Acknowledgements:

This research is funded by:

Developed by: