Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Catenulispora acidiphila DSM 44928  

Data for CP001700  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001700.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001700_8281 CDS_9741174-9739831 99.6 9.8e-29 1
CP001700_6600 CDS_7736682-7737998 92.2 1.5e-26 1
CP001700_1917 CDS_2209400-2208072 89.8 7.7e-26 1
CP001700_7033 CDS_8331987-8333231 88.5 1.8e-25 1
CP001700_5105 CDS_5977287-5978468 88.4 1.9e-25 1
CP001700_5780 CDS_6784875-6786134 88.2 2.3e-25 1
CP001700_6979 CDS_8263993-8265381 82.3 1.2e-23 1
CP001700_6839 CDS_8053011-8051812 79.7 7.4e-23 1
CP001700_8757 CDS_10309916-10311283 79.5 8.6e-23 1
CP001700_3696 CDS_4233258-4232077 77.6 3.1e-22 1
CP001700_7287 CDS_8598377-8597241 76.9 4.8e-22 1
CP001700_0934 CDS_1100240-1099104 76.9 4.9e-22 1
CP001700_5993 CDS_7012755-7014086 75.7 1.1e-21 1
CP001700_7526 CDS_8884098-8885402 74.5 2.5e-21 1
CP001700_7711 CDS_9100453-9101661 74.4 2.6e-21 1
CP001700_5623 CDS_6603266-6601947 73.4 5.1e-21 1
CP001700_5331 CDS_6252961-6254274 73.2 6e-21 1
CP001700_0174 CDS_186609-187907 73.1 6.4e-21 1
CP001700_0662 CDS_791675-792976 73.0 7.1e-21 1
CP001700_5952 CDS_6973669-6972341 72.8 8e-21 1
CP001700_0619 CDS_744633-743488 72.5 9.5e-21 1
CP001700_2618 CDS_3044965-3043685 71.3 2.2e-20 1
CP001700_0742 CDS_892223-893536 70.8 3e-20 1
CP001700_7217 CDS_8528714-8530060 70.8 3.2e-20 1
CP001700_7680 CDS_9062977-9063852 69.6 7e-20 1
CP001700_3602 CDS_4089585-4087750 69.5 7.6e-20 2
CP001700_0616 CDS_740810-742102 68.4 1.6e-19 1
CP001700_1581 CDS_1835043-1836266 67.2 3.5e-19 1
CP001700_6856 CDS_8079101-8077932 66.3 6.5e-19 1
CP001700_1225 CDS_1426362-1424971 64.4 2.3e-18 1
CP001700_0199 CDS_216490-215132 62.0 1.2e-17 1
CP001700_4364 CDS_5072549-5071317 59.7 6e-17 1
CP001700_6423 CDS_7527920-7526802 58.8 1.1e-16 1
CP001700_1881 CDS_2172460-2173692 55.0 1.4e-15 1
CP001700_1861 CDS_2151639-2152814 48.8 9.1e-14 1
CP001700_0157 CDS_168402-167197 47.6 2.1e-13 1
CP001700_3186 CDS_3571061-3570381 47.5 2.3e-13 1
CP001700_0670 CDS_801459-803558 44.9 1.3e-12 2
CP001700_0590 CDS_710696-712024 42.8 5.4e-12 1
CP001700_0204 CDS_222020-220680 39.2 6.4e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001700_8281 1/1 230 297 .. 1 70 [] 99.6 9.8e-29
CP001700_6600 1/1 186 253 .. 1 70 [] 92.2 1.5e-26
CP001700_1917 1/1 187 254 .. 1 70 [] 89.8 7.7e-26
CP001700_7033 1/1 196 263 .. 1 70 [] 88.5 1.8e-25
CP001700_5105 1/1 181 248 .. 1 70 [] 88.4 1.9e-25
CP001700_5780 1/1 188 255 .. 1 70 [] 88.2 2.3e-25
CP001700_6979 1/1 219 286 .. 1 70 [] 82.3 1.2e-23
CP001700_6839 1/1 186 253 .. 1 70 [] 79.7 7.4e-23
CP001700_8757 1/1 215 283 .. 1 70 [] 79.5 8.6e-23
CP001700_3696 1/1 172 241 .. 1 70 [] 77.6 3.1e-22
CP001700_7287 1/1 164 231 .. 1 70 [] 76.9 4.8e-22
CP001700_0934 1/1 176 243 .. 1 70 [] 76.9 4.9e-22
CP001700_5993 1/1 238 305 .. 1 70 [] 75.7 1.1e-21
CP001700_7526 1/1 171 238 .. 1 70 [] 74.5 2.5e-21
CP001700_7711 1/1 185 251 .. 1 70 [] 74.4 2.6e-21
CP001700_5623 1/1 223 290 .. 1 70 [] 73.4 5.1e-21
CP001700_5331 1/1 228 297 .. 1 70 [] 73.2 6e-21
CP001700_0174 1/1 196 262 .. 1 70 [] 73.1 6.4e-21
CP001700_0662 1/1 222 290 .. 1 70 [] 73.0 7.1e-21
CP001700_5952 1/1 204 272 .. 1 70 [] 72.8 8e-21
CP001700_0619 1/1 189 259 .. 1 70 [] 72.5 9.5e-21
CP001700_2618 1/1 226 293 .. 1 70 [] 71.3 2.2e-20
CP001700_0742 1/1 229 307 .. 1 70 [] 70.8 3e-20
CP001700_7217 1/1 256 317 .. 1 64 [. 70.8 3.2e-20
CP001700_7680 1/1 59 138 .. 1 70 [] 69.6 7e-20
CP001700_0616 1/1 228 295 .. 1 70 [] 68.4 1.6e-19
CP001700_1581 1/1 201 268 .. 1 70 [] 67.2 3.5e-19
CP001700_6856 1/1 195 255 .. 1 63 [. 66.3 6.5e-19
CP001700_1225 1/1 273 340 .. 1 70 [] 64.4 2.3e-18
CP001700_0199 1/1 254 325 .. 1 70 [] 62.0 1.2e-17
CP001700_4364 1/1 218 285 .. 1 70 [] 59.7 6e-17
CP001700_6423 1/1 168 233 .. 1 70 [] 58.8 1.1e-16
CP001700_1881 1/1 215 282 .. 1 70 [] 55.0 1.4e-15
CP001700_3602 2/2 419 477 .. 1 61 [. 50.6 2.8e-14
CP001700_1861 1/1 186 253 .. 1 70 [] 48.8 9.1e-14
CP001700_0157 1/1 193 263 .. 1 70 [] 47.6 2.1e-13
CP001700_3186 1/1 181 220 .. 1 42 [. 47.5 2.3e-13
CP001700_0670 2/2 512 579 .. 1 70 [] 43.0 5e-12
CP001700_0590 1/1 246 319 .. 1 70 [] 42.8 5.4e-12
CP001700_0204 1/1 252 324 .. 3 70 .] 39.2 6.4e-11

Alignments of top-scoring domains:
CP001700_8281: domain 1 of 1, from 230 to 297: score 99.6, E = 9.8e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++ +q+++a ++l d dpe+ar+al +i
CP001700_8 230 ERARIARELHDVVAHNVSVMVVQADGAGYAL--DQDPEAARKALLAI 274

relarealaevRrllgdLRpaal<-*
+++r+al+e+Rr+lg+LR a++
CP001700_8 275 SQTGRTALTEMRRMLGVLRSAED 297

CP001700_6600: domain 1 of 1, from 186 to 253: score 92.2, E = 1.5e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+ +++Ls+i++q+++ar ++ dk+pe a++al++i
CP001700_6 186 ERIRIARELHDVTAHHLSVIAVQAGVARFVI--DKEPETADQALRAI 230

relarealaevRrllgdLRpaal<-*
e ++e+lae+Rrl++ LRp ++
CP001700_6 231 SEVGSEGLAELRRLISLLRPEDD 253

CP001700_1917: domain 1 of 1, from 187 to 254: score 89.8, E = 7.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++++++ q+++a++l+ ++dp a eal++i
CP001700_1 187 ERMRIARELHDVVAHHITLVNAQAGVAHHLM--KTDPSHAYEALERI 231

relarealaevRrllgdLRpaal<-*
r+++r al+e+R+++g LR +++
CP001700_1 232 RDTSRSALDELRATVGLLRASDE 254

CP001700_7033: domain 1 of 1, from 196 to 263: score 88.5, E = 1.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHDsvg++L++i++q+++a r++ d+d +++real+ +
CP001700_7 196 ERLRIARDLHDSVGHQLALISVQSDVAGRAI--DTDGPAVREALAHV 240

relarealaevRrllgdLRpaal<-*
++++r+al e+R++++ LR +++
CP001700_7 241 KAASRQALGELRDTVSLLRQPGD 263

CP001700_5105: domain 1 of 1, from 181 to 248: score 88.4, E = 1.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD v+Q L+a++l +++a+ +l d+dp++ar++l+++
CP001700_5 181 ERNRLARELHDAVAQKLFALRLTSQAAAEVL--DTDPARARAELEQV 225

relarealaevRrllgdLRpaal<-*
++la+ea +e+R ++ +LRpa+l
CP001700_5 226 ATLAKEAAEELRSVVVELRPAEL 248

CP001700_5780: domain 1 of 1, from 188 to 255: score 88.2, E = 2.3e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q+e+ar ++ + p++ +e+l +i
CP001700_5 188 ERARIARELHDVVAHHISMIAVQAETARLAT--PGMPPAGAERLLAI 232

relarealaevRrllgdLRpaal<-*
++ar +l+e+Rrllg+LR++a
CP001700_5 233 GDTARAGLTEMRRLLGVLREDAG 255

CP001700_6979: domain 1 of 1, from 219 to 286: score 82.3, E = 1.2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD +++s+ i++q+++ r++ + p+ea++al++i
CP001700_6 219 ERLRIARELHDMIAHSIGIIAIQAGMGNRVI--GTQPAEAQKALHAI 263

relarealaevRrllgdLRpaal<-*
+e++r++l+++Rr+l++LR+++
CP001700_6 264 EETSRDTLSQLRRTLTALRHGEN 286

CP001700_6839: domain 1 of 1, from 186 to 253: score 79.7, E = 7.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDsv++s+ i++ +++a+r++ d+ pe+ r+al+ i
CP001700_6 186 ERLRIARELHDSVAHSIGIITVLSGAAARVV--DTKPEQTRQALTGI 230

relarealaevRrllgdLRpaal<-*
++++re+l e+ r+lg+LR a+
CP001700_6 231 ETTSRETLLELQRMLGALRRAEP 253

CP001700_8757: domain 1 of 1, from 215 to 283: score 79.5, E = 8.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRI RELHD+v++++s++++q+e+a ++ + +ea++++ i
CP001700_8 215 ERARIGRELHDVVAHHMSLLAVQAETAPFRI--TGQSPEAEAEFLSI 259

relarealaevRrllgdLR.paal<-*
+ +real+++R llg LR ++a+
CP001700_8 260 ASVSREALNDMRKLLGLLRaDSAE 283

CP001700_3696: domain 1 of 1, from 172 to 241: score 77.6, E = 3.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD vg++ ++i++q+++++ lld d+d ++are l+ i
CP001700_3 172 ERLRIARDLHDAVGHHVALINVQAGALACLLD-DEDLGRARESLAHI 217

relarealaevRrllgdLR.paal<-*
+++++eal+e+R ++g LR p+a
CP001700_3 218 QRAGEEALEELRLTVGLLRaPGAA 241

CP001700_7287: domain 1 of 1, from 164 to 231: score 76.9, E = 4.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ +a+ +q+++a+ ll ++pe++ + l+ +
CP001700_7 164 ERARIARELHDVVTHHVTAMVVQADAAQFLL--SSHPERVVAGLTSV 208

relarealaevRrllgdLRpaal<-*
+++r+al+e+R llg+L +++
CP001700_7 209 SDTGRRALTELRYLLGVLEATGD 231

CP001700_0934: domain 1 of 1, from 176 to 243: score 76.9, E = 4.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR++HD+vg++ +++ +q+e+ l+ ++ pe+a++a+++i
CP001700_0 176 ERVRIARDMHDVVGHAVALMVVQAEAGPLLV--RDKPERAEAAFEAI 220

relarealaevRrllgdLRpaal<-*
+++r+a+a++R llg+L+ ++
CP001700_0 221 SAAGRDAMAQLRGLLGTLHQDEG 243

CP001700_5993: domain 1 of 1, from 238 to 305: score 75.7, E = 1.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+RE+HD+v+++Ls+i +q+++a ++l d p+ r al++i
CP001700_5 238 ERGRISREMHDVVAHGLSLIVIQAQGADAAL--DNRPADTRSALRAI 282

relarealaevRrllgdLRpaal<-*
+++r++la++Rr+l +L + ++
CP001700_5 283 VRTGRDSLADMRRVLAALGEVED 305

CP001700_7526: domain 1 of 1, from 171 to 238: score 74.5, E = 2.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD++++++s+i+l++++++ + dp++ar+++ i
CP001700_7 171 ERARIAREMHDVLAHRISLIALHAGGLEITE--RPDPGAARQTAGLI 215

relarealaevRrllgdLRpaal<-*
re+ar al+++R++lg+L ++
CP001700_7 216 RETARSALEDLRDVLGVLASGDT 238

CP001700_7711: domain 1 of 1, from 185 to 251: score 74.4, E = 2.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++Ls+i++q+++a + ++e+ r++l++i
CP001700_7 185 ERLRIARELHDVVAHALSLITVQAGVAVFRR---HEAEQMRATLTAI 228

relarealaevRrllgdLRpaal<-*
+e++r a+ ++R+llg+LR +
CP001700_7 229 EETGRSAMVDMRQLLGVLRSDPA 251

CP001700_5623: domain 1 of 1, from 223 to 290: score 73.4, E = 5.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARE HD+v +sLs++ +++a +++ ++ p++a+ea++ +
CP001700_5 223 ERASIAREVHDVVTHSLSVMVALTDGASYAV--HTSPDRAAEAVEKA 267

relarealaevRrllgdLRpaal<-*
e +r+a++++ r+lg+LR +a
CP001700_5 268 SEVGRQAITDMQRVLGVLRGSAG 290

CP001700_5331: domain 1 of 1, from 228 to 297: score 73.2, E = 6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER RIAR+ HD++++sLs++++qle+a +ll ++ ++ ++a + +
CP001700_5 228 ERGRIARDVHDVLAHSLSGLAIQLEAADALL--TDGADveRAHTMVI 272

eirelarealaevRrllgdLRpaal<-*
++r+lar++l+evRr++++LR+++
CP001700_5 273 RARRLARDGLSEVRRAVTALREDVK 297

CP001700_0174: domain 1 of 1, from 196 to 262: score 73.1, E = 6.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+L++i qle+++ ++ d+d e+ + +l+ +
CP001700_0 196 ERQRLAGEIHDTIAQGLTGIVRQLEVVE-RF--DDDVERRKHHLTLA 239

relarealaevRrllgdLRpaal<-*
relare+lae+Rr +++LRp+ l
CP001700_0 240 RELARESLAEARRSVQALRPGPL 262

CP001700_0662: domain 1 of 1, from 222 to 290: score 73.0, E = 7.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA ELHD+v+++ s++ +q+++ar++l dk p+ areal ++
CP001700_0 222 ERARIAAELHDVVSHNVSVMVVQAGAARKVL--DKSPDLAREALLAV 266

relarealaevRrllgdLR.paal<-*
++ +r a+ae+R++ g L +++
CP001700_0 267 EDSGRAAMAELRHVMGLLTmTSQG 290

CP001700_5952: domain 1 of 1, from 204 to 272: score 72.8, E = 8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD++++s+s+i++q+ +a+ ++ d+ pe+ar al +i
CP001700_5 204 ERLEIARELHDVLAHSISLIAVQANVALEVM--DRRPEQARIALSAI 248

relarealaevRrllgdLR.paal<-*
++++r al evR +l++LR++ a
CP001700_5 249 KDASRSALGEVRSVLTVLRgDRAA 272

CP001700_0619: domain 1 of 1, from 189 to 259: score 72.5, E = 9.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARE+HD +++sL a+++q+e+a++ll+ +++p+ +a + ++
CP001700_0 189 ERTRIAREIHDILAHSLGALAMQVEAAQALLT-QENPDiaKAVRCVE 234

eirelarealaevRrllgdLRpaal<-*
++ +l re+l e Rr++++LR+++
CP001700_0 235 RAGQLTREGLVESRRAVHALREDIG 259

CP001700_2618: domain 1 of 1, from 226 to 293: score 71.3, E = 2.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDs g+++ +i +q+++ar l d+dp++ r+a++ i
CP001700_2 226 ERTRIARELHDSAGHAINVILVQAGAARLLH--DRDPARSRQAVEVI 270

relarealaevRrllgdLRpaal<-*
++ ar +l+e+ +l+ +LR+++
CP001700_2 271 EDVARATLTEIGHLVLALREDQG 293

CP001700_0742: domain 1 of 1, from 229 to 307: score 70.8, E = 3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER R+AR+LHD g+sL+ i+l++ela+r+l +k+ + +++++++
CP001700_0 229 ERLRLARDLHDLTGHSLATITLKAELAQRML--AKARDaapegptpr 273

..earealdeirelarealaevRrllgdLRpaal<-*
++a ++++ei++ +r++l+++R++++++R a+l
CP001700_0 274 ldAALKEVQEIEQVSRQTLTDIRQAVSGYRRATL 307

CP001700_7217: domain 1 of 1, from 256 to 317: score 70.8, E = 3.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+++++ + +++a++ l d+dp+ re+ld +
CP001700_7 256 ERERLAREIHDTLAQGFTSLLMLVQAAEATL--DTDPATTRERLDLA 300

relarealaevRrllgd<-*
+++are lae+R+l+g+
CP001700_7 301 ARTARENLAEARALIGG 317

CP001700_7680: domain 1 of 1, from 59 to 138: score 69.6, E = 7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER RIARELHD v+++ s++ +q+++ar++l +++p+++ + +++
CP001700_7 59 ERSRIARELHDIVSHNVSMMLIQAGAARQVL--AAAPAqsataeepa 103

...earealdeirelarealaevRrllgdLRpaal<-*
++ a++al +++ ++r +++e+R+llg+L paa+
CP001700_7 104 asgVAEDALLAVESAGRATMTELRHLLGVLAPAAD 138

CP001700_0616: domain 1 of 1, from 228 to 295: score 68.4, E = 1.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ ++l +a +l+ ++dpe+a++ l e+
CP001700_0 228 ELRRIERDLHDGAQARLVAMGMHLNAASQLM--ERDPEAAQKLLSEA 272

relarealaevRrllgdLRpaal<-*
r+ + +al+e+R+l+++++p++l
CP001700_0 273 RDSSAKALSELRDLVRGIHPPVL 295

CP001700_1581: domain 1 of 1, from 201 to 268: score 67.2, E = 3.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD v++ + +++lq+++ar ++ + p++a++al i
CP001700_1 201 ERLRIARDLHDMVAHEIGVVALQAGAARLVV--LRRPDAAEQALGII 245

relarealaevRrllgdLRpaal<-*
++++r++la +Rr++ +L++a
CP001700_1 246 EDTSRTTLAGLRRMVATLHDAPA 268

CP001700_6856: domain 1 of 1, from 195 to 255: score 66.3, E = 6.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i++ +e+ar+ + ++ p++ ++l i
CP001700_6 195 ERQRLAREIHDTLAQGFASIIVLAEAARAGI--AASPAKSSQQLLSI 239

relarealaevRrllg<-*
+++are lae+R l+g
CP001700_6 240 ERTARENLAEARVLVG 255

CP001700_1225: domain 1 of 1, from 273 to 340: score 64.4, E = 2.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L +++++l+ ar+ l ++ p+ea + +
CP001700_1 273 ERRRIERDLHDGAQQRLMSLAVHLGIARKTL--KDVPPEAMSVIIDA 317

relarealaevRrllgdLRpaal<-*
+e +++a+ae+R+l+++++pa+l
CP001700_1 318 HEQVKDAMAEIRDLVRGMHPAVL 340

CP001700_0199: domain 1 of 1, from 254 to 325: score 62.0, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ER+RI R+LHD+ Q+L a+++ l++a+ l ++ +e ++++a++
CP001700_0 254 ERRRIERDLHDGAQQRLVALAMDLGRAKSKL--KTGDEadseAAAQL 298

ldeirelarealaevRrllgdLRpaal<-*
++e++e ++ al+e+R+l+++++pa+l
CP001700_0 299 VAEAHEGVKLALSELRDLARGIHPAVL 325

CP001700_4364: domain 1 of 1, from 218 to 285: score 59.7, E = 6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L +++l l+la +++ d+dp+ ar+ + +
CP001700_4 218 ELRRIERDLHDGTQAQLVSAALRLGLADQRF--DADPGGARKLMLDA 262

relarealaevRrllgdLRpaal<-*
r+ +++alae+R+++++++p++l
CP001700_4 263 RTGIEDALAELRDVIRGIHPPIL 285

CP001700_6423: domain 1 of 1, from 168 to 233: score 58.8, E = 1.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD++++sLs+++ ++a+++ ++ ar++++++
CP001700_6 168 ERTRLAREMHDVIAHSLSVMITLNDAAAAVE--PSQ--LARDTIAQA 210

relarealaevRrllgdLRpaal<-*
+ +r+al e+ r+lg+LR ++
CP001700_6 211 SDVGRQALGEMHRMLGVLRGEED 233

CP001700_1881: domain 1 of 1, from 215 to 282: score 55.0, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L+a+ l l++a+ l+ +++p+ea + l+e+
CP001700_1 215 EMRRIERDLHDGAQARLAAVGLSLGMAEDLV--RENPDEAIALLAEA 259

relarealaevRrllgdLRpaal<-*
re++ alae+R l++++ p++l
CP001700_1 260 REHSGAALAELRSLVRGILPPVL 282

CP001700_3602: domain 2 of 2, from 419 to 477: score 50.6, E = 2.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD++g +Lsa++l+ ela rll d+dp++a++++ ++
CP001700_3 419 ERTRIARDLHDVLGFRLSAVALKGELAVRLL--DRDPARAADEVGAL 463

relarealaevRrl<-*
e + +++ e+ ++
CP001700_3 464 IEVVGDGILELQDV 477

CP001700_1861: domain 1 of 1, from 186 to 253: score 48.8, E = 9.1e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD gQ+L + +l+l la +ll ++dp+ ar++l+e+
CP001700_1 186 ERYRFAADLHDIQGQALHVSRLKLRLADKLL--AEDPAVARTHLREA 230

relarealaevRrllgdLRpaal<-*
++l+ +a+ae+Rrl+ + R+ ++
CP001700_1 231 EQLIADAIAETRRLAYGQRTLTF 253

CP001700_0157: domain 1 of 1, from 193 to 263: score 47.6, E = 2.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
R+RIAR+LHD Q+++a+ l l+++ r+l ++ ++ ++a+ +l
CP001700_0 193 DRERIARDLHDLTIQRIFAAGLSLQTLSRRL--NSPGPdlpAAAGRL 237

deirelarealaevRrllgdLRpaal<-*
d + + ++ a+ae+R ++ dL+ +a+
CP001700_0 238 DGVIDELDAAIAEIRTTIFDLQLTAD 263

CP001700_3186: domain 1 of 1, from 181 to 220: score 47.5, E = 2.3e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeeare<-*
ER RIAR+LHDsv+++++ i++q+ +a++++ ++ p++a e
CP001700_3 181 ERLRIARDLHDSVAHAMATINVQAAAAAHVI--ERRPQAAGE 220

CP001700_0670: domain 2 of 2, from 512 to 579: score 43.0, E = 5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g++L+ai l++elarrl +dp++ ++++ +
CP001700_0 512 ERLRAARDLHDLLGHGLAAILLKAELARRLR--STDPARCLAEIRDV 556

relarealaevRrllgdLRpaal<-*
++la ++ +e+R+l g+ R+ +
CP001700_0 557 ERLAAQGESELRALTGGSRELSF 579

CP001700_0590: domain 1 of 1, from 246 to 319: score 42.8, E = 5.4e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpe..earea
+RI R+LHD+ +L a+ +ql +++ l +++++dp + r
CP001700_0 246 TLRRIERDLHDGAQARLVALGMQLVMLKDSLGGeqADDPRleSSRGL 292

ldeirelarealaevRrllgdLRpaal<-*
+d+++ +a++a+ae+R+l+++++p++l
CP001700_0 293 IDQAQVTAKTAIAELRDLVRGIHPPTL 319

CP001700_0204: domain 1 of 1, from 252 to 324: score 39.2, E = 6.4e-11
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpe......earea
+RI R+LHD+ +L a+++ql+ a+ ld + ++ + + +e r+
CP001700_0 252 RRIERDLHDGAQAQLVALAMQLGEAKENLD-AGGNGaeldltETRTL 297

ldeirelarealaevRrllgdLRpaal<-*
+d++++ a++a++e+R+l+++++paal
CP001700_0 298 IDTAHRNAKQAINELRDLARGIHPAAL 324


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-14 10 0|=
-13 88 1|*===
-12 146 99|===*==
-11 333 816|============== *
-10 928 1895|====================================== *
-9 1418 2152|========================================================= *
-8 1289 1659|==================================================== *
-7 1217 1043|=========================================*=======
-6 1045 590|=======================*==================
-5 973 316|============*==========================
-4 510 165|======*==============
-3 336 85|===*==========
-2 212 43|=*=======
-1 134 22|*=====
0 89 11|*===
1 56 5|*==
2 31 2|*=
3 26 1|*=
4 10 0|=
5 7 0|=
6 4 0|=
7 4 0|=
8 2 0|=
9 2 0|=
10 0 0|
> 11 44 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 6536.6426
P(chi-square) = 0

Total sequences searched: 8914

Whole sequence top hits:
tophits_s report:
Total hits: 40
Satisfying E cutoff: 40
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 40
Satisfying E cutoff: 40
Total memory: 35K


Acknowledgements:

This research is funded by:

Developed by: