Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Jonesia denitrificans DSM 20603  

Data for CP001706  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001706.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001706_1836 CDS_2049866-2051134 93.2 2.1e-27 1
CP001706_2466 CDS_2699182-2700456 83.5 1.6e-24 1
CP001706_0113 CDS_129594-130742 76.9 1.3e-22 1
CP001706_1572 CDS_1726772-1725360 72.1 3.6e-21 1
CP001706_1627 CDS_1795220-1796449 66.7 1.4e-19 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001706_1836 1/1 211 278 .. 1 70 [] 93.2 2.1e-27
CP001706_2466 1/1 213 281 .. 1 70 [] 83.5 1.6e-24
CP001706_0113 1/1 173 241 .. 1 70 [] 76.9 1.3e-22
CP001706_1572 1/1 264 329 .. 1 70 [] 72.1 3.6e-21
CP001706_1627 1/1 180 250 .. 1 70 [] 66.7 1.4e-19

Alignments of top-scoring domains:
CP001706_1836: domain 1 of 1, from 211 to 278: score 93.2, E = 2.1e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD v++sLs+++ q+++ r+++ +++p+ a++al++i
CP001706_1 211 ERTRIAREMHDIVAHSLSVMIAQADGGRYAA--ATNPDLAATALTTI 255

relarealaevRrllgdLRpaal<-*
+e++r ala++Rrllg+LR+++
CP001706_1 256 AETGRAALADMRRLLGVLREGDS 278

CP001706_2466: domain 1 of 1, from 213 to 281: score 83.5, E = 1.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARE+HD++++++s+++l+++++++++ d +p+++re+++ i
CP001706_2 213 ERSLIAREMHDVLAHRISLVALHSGALAYRT--DLNPDQVRETAEII 257

relarealaevRrllgdLR.paal<-*
re +++al+e+R++lg+LR+p++
CP001706_2 258 RENSHRALTELRQVLGVLRdPTVP 281

CP001706_0113: domain 1 of 1, from 173 to 241: score 76.9, E = 1.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+ HDs+g++L+++++++ela rl+ + pe+a+++l e+
CP001706_0 173 ERERLARDVHDSLGHTLTVVSIKAELASRLV--SSQPERAARELVEV 217

relarealaevRrllgdLR.paal<-*
r+++r+al++vR+++++L ++++
CP001706_0 218 RDHVRDALSQVRDVVTGLThHSIA 241

CP001706_1572: domain 1 of 1, from 264 to 329: score 72.1, E = 3.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARE+HD+v+++Ls+++lq++++++ +++ + + ++++
CP001706_1 264 EREQIAREMHDTVAHQLSLVSLQASVLEMSS--KDP--TVPDSARAM 306

relarealaevRrllgdLRpaal<-*
re++++al+++R l++ LR++ +
CP001706_1 307 RETVHRALDDMRGLITSLRDSSD 329

CP001706_1627: domain 1 of 1, from 180 to 250: score 66.7, E = 1.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIAR+LHD Q+L+a +qle++rr++ ++ ++ + + ld
CP001706_1 180 ERERIARDLHDLAIQQLFATGMQLEVVRRRA--ARGLDkaGLIAILD 224

eirelarealaevRrllgdLR.paal<-*
e+ + ++ + +e+R +++ LR+p+a
CP001706_1 225 EALDNVDNSVREIRSIVHSLRdPDAA 250


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-14 8 0|=
-13 31 0|====
-12 72 28|===*=====
-11 103 230|============= *
-10 289 534|===================================== *
-9 420 606|===================================================== *
-8 362 467|============================================== *
-7 353 293|====================================*========
-6 282 166|====================*===============
-5 245 89|===========*===================
-4 120 46|=====*=========
-3 75 23|==*=======
-2 55 12|=*=====
-1 37 6|*====
0 23 3|*==
1 6 1|*
2 8 0|=
3 8 0|=
4 3 0|=
5 4 0|=
6 0 0|
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1223.2852
P(chi-square) = 0

Total sequences searched: 2511

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: