Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

1 accessions found for Robiginitalea biformata HTCC2501  

Data for CP001712  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001712.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001712_1659 CDS_1830633-1829389 145.8 2.1e-41 1
CP001712_2459 CDS_2704417-2702495 127.3 4e-36 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001712_1659 1/1 211 299 .. 1 94 [] 145.8 2.1e-41
CP001712_2459 1/1 449 535 .. 1 94 [] 127.3 4e-36

Alignments of top-scoring domains:
CP001712_1659: domain 1 of 1, from 211 to 299: score 145.8, E = 2.1e-41
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ++SSLLr+Q+r+++d+++ l + r sqnRV +
CP001712_1 211 EVHHRVKNNLQTVSSLLRMQSRSIEDPDT-----LSLIRSSQNRVVA 252

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mA++HE+LY+ edl++++ ++Y+++L e+L++s + ++isLk D+
CP001712_1 253 MAMVHEMLYMREDLSKIEYRSYVQELGEYLIRSIKGPQNKISLKIDI 299

CP001712_2459: domain 1 of 1, from 449 to 535: score 127.3, E = 4e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ++SSLL+LQ+ +++++++ +eaL+E RV++
CP001712_2 449 EIHHRVKNNLQMVSSLLSLQTKNTRSRAA-----IEALEEGKTRVKA 490

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH++LY+++dl+ +++ Y+e L+++ + + +g+++i+++ +
CP001712_2 491 MALIHQKLYQNDDLSVIEMQGYIESLINSVQSVFKKGGHNINIS--I 535


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 12 0|=
-14 25 0|===
-13 53 20|=*===
-12 133 210|============ *
-11 702 587|================================================*==========
-10 667 759|======================================================== *
-9 539 641|============================================= *
-8 422 430|===================================*
-7 249 255|=====================*
-6 240 142|===========*========
-5 87 76|======*=
-4 38 40|===*
-3 20 21|=*
-2 13 11|*=
-1 5 5|*
0 2 3|*
1 1 1|*
2 0 0|
> 3 3 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 202.0894
P(chi-square) = 1.208e-36

Total sequences searched: 3211

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: