Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Candidatus Accumulibacter phosphatis clade IIA str. UW-1  

Data for CP001715  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001715.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001715_0686 CDS_837668-835143 64.8 8.7e-19 1
CP001715_3593 CDS_4257814-4256027 40.7 1.2e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001715_0686 1/1 642 709 .. 1 70 [] 64.8 8.7e-19
CP001715_3593 1/1 395 462 .. 1 70 [] 40.7 1.2e-11

Alignments of top-scoring domains:
CP001715_0686: domain 1 of 1, from 642 to 709: score 64.8, E = 8.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD +g +L++++ + la ++ + + ++ +++l ++
CP001715_0 642 ERVRIARELHDDLGSTLTGVRWAIALAIERA--QQATPPGDAQLPQA 686

relarealaevRrllgdLRpaal<-*
+l++ a + +Rr++ dLRp++l
CP001715_0 687 LQLVDSAVDAMRRIINDLRPSVL 709

CP001715_3593: domain 1 of 1, from 395 to 462: score 40.7, E = 1.2e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+++Q+L+ai+ + +++r +++ e++ +a+++i
CP001715_3 395 ERVALARELHDELAQHLTAIRAFAAAIQRDK--ATPHERILAAARAI 439

relarealaevRrllgdLRpaal<-*
ar+ ++ rl +L+p++l
CP001715_3 440 DVSARDIYEVSHRLMEGLHPSIL 462


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 11 0|=
-13 49 0|====
-12 89 48|===*===
-11 160 396|============= *
-10 429 919|================================= *
-9 710 1044|======================================================= *
-8 594 805|============================================== *
-7 586 506|======================================*=======
-6 544 286|=====================*====================
-5 449 153|===========*=======================
-4 235 80|======*============
-3 190 41|===*===========
-2 112 21|=*=======
-1 60 10|*====
0 45 5|*===
1 26 2|*=
2 9 1|*
3 11 0|=
4 3 0|=
5 6 0|=
> 6 8 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3151.4749
P(chi-square) = 0

Total sequences searched: 4326

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: