Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Eggerthella lenta DSM 2243  

Data for CP001726  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001726.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001726_2775 CDS_3278683-3277442 83.2 2.3e-24 1
CP001726_0554 CDS_717493-718599 60.4 1.2e-17 1
CP001726_1714 CDS_2052798-2051599 41.3 5.2e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001726_2775 1/1 197 265 .. 1 70 [] 83.2 2.3e-24
CP001726_0554 1/1 170 236 .. 1 70 [] 60.4 1.2e-17
CP001726_1714 1/1 195 259 .. 1 70 [] 41.3 5.2e-12

Alignments of top-scoring domains:
CP001726_2775: domain 1 of 1, from 197 to 265: score 83.2, E = 2.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE HD ++sLsa+++q+ +a+r++ d+dp++a+ea+ ++
CP001726_2 197 ERVRIAREVHDITAHSLSAVSIQAAAAERMI--DRDPAAAKEAISAV 241

relarealaevRrllgdLR.paal<-*
r++a+ ala++R ++g+LR ++
CP001726_2 242 RTTAKGALADIRSMIGVLRcGDDA 265

CP001726_0554: domain 1 of 1, from 170 to 236: score 60.4, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD vg+ L+ lq+e+++ ++ ++d+e +r l+ +
CP001726_0 170 ERSRIAREIHDNVGHLLTRSVLQVEALQ-VV--HADDECVRGGLASV 213

relarealaevRrllgdLRpaal<-*
++++e ++ vR ++dL+++a+
CP001726_0 214 GATLHEVMDTVRKSVHDLHDDAF 236

CP001726_1714: domain 1 of 1, from 195 to 259: score 41.3, E = 5.2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+RELHD+++Q L ++ ++ + + +ee e l+e+
CP001726_1 195 ERKRISRELHDGIAQELLTLSFVFKRLVAYV-----DEEGYELLAEA 236

relarealaevRrllgdLRpaal<-*
+ l+e+ +l LRp+al
CP001726_1 237 NNDLANVLDELHNLSVKLRPSAL 259


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 8 0|=
-13 35 0|====
-12 72 34|===*====
-11 126 281|============= *
-10 443 652|============================================= *
-9 560 741|======================================================== *
-8 456 571|============================================== *
-7 402 359|===================================*=====
-6 278 203|====================*=======
-5 308 109|==========*====================
-4 147 56|=====*=========
-3 94 29|==*=======
-2 54 14|=*====
-1 46 7|*====
0 19 3|*=
1 7 1|*
2 6 0|=
3 2 0|=
4 1 0|=
> 5 6 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1238.8506
P(chi-square) = 0

Total sequences searched: 3070

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: