Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Kribbella flavida DSM 17836  

Data for CP001736  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001736.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001736_4199 CDS_4628458-4629615 91.0 2.6e-26 1
CP001736_5585 CDS_6144031-6142814 90.2 4.5e-26 1
CP001736_0348 CDS_355656-356897 88.9 1.1e-25 1
CP001736_2612 CDS_2811660-2813210 86.5 5.7e-25 1
CP001736_4715 CDS_5202865-5204073 83.7 3.7e-24 1
CP001736_2284 CDS_2442779-2444017 81.6 1.6e-23 1
CP001736_6471 CDS_7073496-7074701 81.3 1.9e-23 1
CP001736_1641 CDS_1770206-1769136 80.7 2.9e-23 1
CP001736_6839 CDS_7469264-7468113 79.3 7.3e-23 1
CP001736_4187 CDS_4615713-4613728 79.1 8.7e-23 2
CP001736_3069 CDS_3355832-3354570 76.1 6.6e-22 1
CP001736_0619 CDS_660682-661851 75.3 1.2e-21 1
CP001736_4204 CDS_4633001-4634152 74.1 2.5e-21 2
CP001736_0853 CDS_944027-942684 73.9 3e-21 1
CP001736_2394 CDS_2563005-2561713 71.0 2.1e-20 1
CP001736_5132 CDS_5659280-5660533 70.7 2.7e-20 1
CP001736_5562 CDS_6116677-6117804 69.4 6.3e-20 1
CP001736_4392 CDS_4841978-4840812 68.9 8.9e-20 1
CP001736_4657 CDS_5141633-5140398 68.6 1.1e-19 1
CP001736_4882 CDS_5394496-5395797 68.0 1.6e-19 1
CP001736_2309 CDS_2465628-2464456 64.2 2.2e-18 1
CP001736_1334 CDS_1432722-1433888 60.9 2e-17 1
CP001736_1107 CDS_1202565-1203812 60.3 3e-17 1
CP001736_2065 CDS_2204485-2203364 58.4 1.1e-16 1
CP001736_4380 CDS_4829891-4828692 55.6 7.3e-16 1
CP001736_5634 CDS_6198872-6200044 55.3 9e-16 1
CP001736_3384 CDS_3716291-3717565 53.7 2.6e-15 1
CP001736_3285 CDS_3603951-3605912 51.5 1.2e-14 1
CP001736_1283 CDS_1374225-1375451 51.2 1.5e-14 1
CP001736_0797 CDS_871096-870005 46.4 3.7e-13 1
CP001736_4258 CDS_4693081-4691825 44.7 1.2e-12 1
CP001736_1939 CDS_2068483-2067299 38.7 7.1e-11 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001736_4199 1/1 188 255 .. 1 70 [] 91.0 2.6e-26
CP001736_5585 1/1 195 262 .. 1 70 [] 90.2 4.5e-26
CP001736_0348 1/1 207 274 .. 1 70 [] 88.9 1.1e-25
CP001736_2612 1/1 250 317 .. 1 70 [] 86.5 5.7e-25
CP001736_4715 1/1 199 266 .. 1 70 [] 83.7 3.7e-24
CP001736_2284 1/1 185 252 .. 1 70 [] 81.6 1.6e-23
CP001736_6471 1/1 182 249 .. 1 70 [] 81.3 1.9e-23
CP001736_1641 1/1 170 237 .. 1 70 [] 80.7 2.9e-23
CP001736_6839 1/1 184 250 .. 1 70 [] 79.3 7.3e-23
CP001736_3069 1/1 210 277 .. 1 70 [] 76.1 6.6e-22
CP001736_0619 1/1 180 247 .. 1 70 [] 75.3 1.2e-21
CP001736_0853 1/1 235 302 .. 1 70 [] 73.9 3e-21
CP001736_4204 2/2 179 246 .. 1 70 [] 72.4 8.3e-21
CP001736_2394 1/1 226 294 .. 1 70 [] 71.0 2.1e-20
CP001736_5132 1/1 211 276 .. 1 70 [] 70.7 2.7e-20
CP001736_5562 1/1 180 248 .. 1 70 [] 69.4 6.3e-20
CP001736_4392 1/1 173 240 .. 1 70 [] 68.9 8.9e-20
CP001736_4657 1/1 214 281 .. 1 70 [] 68.6 1.1e-19
CP001736_4882 1/1 231 298 .. 1 70 [] 68.0 1.6e-19
CP001736_4187 1/2 173 240 .. 1 70 [] 67.6 2.1e-19
CP001736_2309 1/1 195 264 .. 1 70 [] 64.2 2.2e-18
CP001736_1334 1/1 175 242 .. 1 70 [] 60.9 2e-17
CP001736_1107 1/1 212 277 .. 1 70 [] 60.3 3e-17
CP001736_2065 1/1 169 236 .. 1 70 [] 58.4 1.1e-16
CP001736_4380 1/1 183 249 .. 1 70 [] 55.6 7.3e-16
CP001736_5634 1/1 177 251 .. 1 70 [] 55.3 9e-16
CP001736_3384 1/1 234 299 .. 1 70 [] 53.7 2.6e-15
CP001736_3285 1/1 185 251 .. 1 70 [] 51.5 1.2e-14
CP001736_1283 1/1 180 255 .. 1 70 [] 51.2 1.5e-14
CP001736_0797 1/1 177 244 .. 1 70 [] 46.4 3.7e-13
CP001736_4258 1/1 189 255 .. 1 70 [] 44.7 1.2e-12
CP001736_1939 1/1 173 241 .. 1 70 [] 38.7 7.1e-11

Alignments of top-scoring domains:
CP001736_4199: domain 1 of 1, from 188 to 255: score 91.0, E = 2.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA+ELHD+v++++s+i++q++ a++l+ d+ pe+a+ al++i
CP001736_4 188 ERLRIAQELHDVVAHHISLINVQASSALHLV--DRQPEQAAPALAAI 232

relarealaevRrllgdLRpaal<-*
+++++eal e+R ++g LR +++
CP001736_4 233 KDASKEALVELRSIVGILRQTDE 255

CP001736_5585: domain 1 of 1, from 195 to 262: score 90.2, E = 4.5e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+v+++Ls +++q+++ ++++ d+ pe+a++al++i
CP001736_5 195 ERTRIAREIHDVVAHGLSIMIVQADGGLYAA--DASPEQAKKALATI 239

relarealaevRrllgdLRpaal<-*
+++r +l+e+R +lg L+ ++
CP001736_5 240 GDTGRASLTEMRKMLGLLKQDEQ 262

CP001736_0348: domain 1 of 1, from 207 to 274: score 88.9, E = 1.1e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RE+HDsv+Q+Ls+i+l l++a r d+ p++are+++++
CP001736_0 207 ERTRLSREIHDSVAQGLSSINLLLQAADREW--DSRPAAAREHAAQA 251

relarealaevRrllgdLRpaal<-*
+++ar++l+evRr+++dL pa+l
CP001736_0 252 AATARDGLDEVRRVVRDLAPAEL 274

CP001736_2612: domain 1 of 1, from 250 to 317: score 86.5, E = 5.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RI+RELHD+v++++s+i +q+++arr++ ++dp++a+ al i
CP001736_2 250 ERLRISRELHDVVAHHISSIGIQAGGARRVM--ESDPAAAKNALSVI 294

relarealaevRrllgdLRpaal<-*
+ +r+a +e+R+llg LR a+
CP001736_2 295 ENSSRTAVNEMRQLLGMLRAADP 317

CP001736_4715: domain 1 of 1, from 199 to 266: score 83.7, E = 3.7e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR++HD v++sL++i q+e+ ++++ +k p++a +al+ i
CP001736_4 199 ERQRIARDMHDIVAHSLAVIVRQAEGGAAIA--AKSPDRAVQALTVI 243

relarealaevRrllgdLRpaal<-*
+++areal+++R +l++LR+a
CP001736_4 244 AGTAREALTDMRGTLQVLREAPP 266

CP001736_2284: domain 1 of 1, from 185 to 252: score 81.6, E = 1.6e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE HD v+++ ++++ +++a++ + ++ pe+a+++++ +
CP001736_2 185 ERTRIAREVHDIVAHNVAVMIALADGAAYTA--TRSPERAADTMTKV 229

relarealaevRrllgdLRpaal<-*
+++r+al e+Rrllg LR+++
CP001736_2 230 SATGRQALGEMRRLLGLLREGET 252

CP001736_6471: domain 1 of 1, from 182 to 249: score 81.3, E = 1.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD v++++++++ q+ +a++l+ + p++ar+ lde+
CP001736_6 182 ERLRIARELHDLVAHQITLANAQANVAAHLF--STSPDKARTSLDEV 226

relarealaevRrllgdLRpaal<-*
e+ r+al+e+R+++g LR ++
CP001736_6 227 VETTRHALDELRATVGLLRQRDD 249

CP001736_1641: domain 1 of 1, from 170 to 237: score 80.7, E = 2.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+ HD +g++L++i+l++ela+rl+ dp++a+++++e+
CP001736_1 170 ERLRFARDVHDLLGHRLAVITLKAELAARLV--SVDPDRAAQEAAEV 214

relarealaevRrllgdLRpaal<-*
++l+ +alaevR++++++R +l
CP001736_1 215 QHLSATALAEVRETVHGYRAVDL 237

CP001736_6839: domain 1 of 1, from 184 to 250: score 79.3, E = 7.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ARELHD+v ++ +a+ +q+e+ar+l+ + pe+++++l++i
CP001736_6 184 ERTRVARELHDVVTHHVTAMVVQAEAARYLT---ASPERLEQTLTAI 227

relarealaevRrllgdLRpaal<-*
+++r+a +++R+llg L p+
CP001736_6 228 TDTGRRAVTDLRHLLGLLNPDHS 250

CP001736_3069: domain 1 of 1, from 210 to 277: score 76.1, E = 6.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsvg++Ls+++lq+ +arr+l ++dp+ a++al+++
CP001736_3 210 ERNRLARELHDSVGHALSLVTLQAAAARRVL--ATDPAFAETALAAM 254

relarealaevRrllgdLRpaal<-*
++ ar ala++ ++lg LR++
CP001736_3 255 ETSARAALADLDHVLGLLRDDRR 277

CP001736_0619: domain 1 of 1, from 180 to 247: score 75.3, E = 1.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA+E+HD++++ s+i+l++++++ + +e+++e + i
CP001736_0 180 ERARIAQEMHDVLAHKVSLIALHAGGLEVNP--AVGAEKVEESAGLI 224

relarealaevRrllgdLRpaal<-*
r++ar+a++++R++lg+LR++
CP001736_0 225 RQTARQAMEDLREVLGVLRTDLS 247

CP001736_0853: domain 1 of 1, from 235 to 302: score 73.9, E = 3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+v++++sa+ + +++a r++ d +p+++rea++ i
CP001736_0 235 ERTRIARDLHDVVSHHMSAVVIRAQAADRVA--DQNPAALREAVRWI 279

relarealaevRrllgdLRpaal<-*
+ ++eal+ +R+++++L +a
CP001736_0 280 IASGKEALTAMRETVRVLNTASP 302

CP001736_4204: domain 2 of 2, from 179 to 246: score 72.4, E = 8.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARE+HD+++++Ls+++ +++++++ d+ pe++++a+ i
CP001736_4 179 ERTKMAREMHDVLAHRLSLLATYAGALEYRP--DSSPEKLAQAAGVI 223

relarealaevRrllgdLRpaal<-*
r +++al+e+R+++++LR+++
CP001736_4 224 RVGVHQALDELREVISVLRDGEI 246

CP001736_2394: domain 1 of 1, from 226 to 294: score 71.0, E = 2.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i + +++a+ l+ + + a+++l++i
CP001736_2 226 ERERMAREIHDTLAQGMTSIVMLAQTAAVELQ-RGGTASAATRLAAI 271

relarealaevRrllgdLRpaal<-*
+++are lae+R+l+ ++ p al
CP001736_2 272 EDTARENLAEARALVAAFTPVAL 294

CP001736_5132: domain 1 of 1, from 211 to 276: score 70.7, E = 2.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+L a+ l l++arr ++dp+ a+e ++++
CP001736_5 211 ERRRIERDLHDGVQQRLVALGLLLSRARR----TSDPAVAAELVRQA 253

relarealaevRrllgdLRpaal<-*
+e +++al ++R+++++ p+al
CP001736_5 254 HEESQQALGDLRDVAWRVYPTAL 276

CP001736_5562: domain 1 of 1, from 180 to 248: score 69.4, E = 6.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARE+HD++g++Ls++++++++++++ d+ ee++ a++ i
CP001736_5 180 AREEIAREMHDVLGHRLSLLSVHAGALAYRP--DASTEEIAGAAEII 224

relarealaevRrllgdLR.paal<-*
r a++al+++R+++g+LR p ++
CP001736_5 225 RSSAHQALQDLREVIGVLRaPVGE 248

CP001736_4392: domain 1 of 1, from 173 to 240: score 68.9, E = 8.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++ +++ +q+++ + ++ ++ pe++ e l ei
CP001736_4 173 ERLELARELHDIVAHHVTGMLIQTQATQVIA--RRTPEKVPESLIEI 217

relarealaevRrllgdLRpaal<-*
++++ ea+a +Rr+lg LR++++
CP001736_4 218 EAAGTEAMAAMRRVLGLLRDTDD 240

CP001736_4657: domain 1 of 1, from 214 to 281: score 68.6, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ++++ +++a++l+ + dpe+a++ ld +
CP001736_4 214 ELRRIERDLHDGTQAQLVSLAMRIGVAKQLM--ANDPEKAAQLLDDA 258

relarealaevRrllgdLRpaal<-*
r+ a++a++e+R +l+++ p++l
CP001736_4 259 RDGAEQAMTELRGVLRTMYPPIL 281

CP001736_4882: domain 1 of 1, from 231 to 298: score 68.0, E = 1.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L+a+++ l++a+ ++ ++dpe+a++ l+e+
CP001736_4 231 ELRRIERDLHDGAQARLAALSMSLGMAEEMV--ARDPEQAAALLTEA 275

relarealaevRrllgdLRpaal<-*
r a++al+e+R+l+++++p++l
CP001736_4 276 RLSASTALSELRDLVRGIHPPVL 298

CP001736_4187: domain 1 of 2, from 173 to 240: score 67.6, E = 2.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD+ +++L++i + +++a+rl d+ pe a eal+ +
CP001736_4 173 ERRRLARDLHDVSAHHLTSIVVSSSAAQRLS--DRQPELAGEALTFA 217

relarealaevRrllgdLRpaal<-*
++++re+l+ +Rrl+ +L +++
CP001736_4 218 AKTGRETLTALRRLVAVLETGER 240

CP001736_2309: domain 1 of 1, from 195 to 264: score 64.2, E = 2.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARELHD++++sL a+++qle+a++ll ++ ++ a e+++
CP001736_2 195 ERTRIARELHDVLAHSLGALSVQLEVAEALL--AERGDtaGALERVR 239

eirelarealaevRrllgdLRpaal<-*
+ r+la ++l+e+R+++ +LR ++
CP001736_2 240 RSRRLAVQGLTEARNAVATLRQDDV 264

CP001736_1334: domain 1 of 1, from 175 to 242: score 60.9, E = 2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDsv+++L+++++++ +ar+ l + p+ a++ald +
CP001736_1 175 ERLRIARELHDSVAHHLAVVSVHTNVARANL--LRSPQVAERALDDV 219

relarealaevRrllgdLRpaal<-*
+ + + l+e+ +l++LR ++
CP001736_1 220 QVATQSVLQELGVVLSVLRASEP 242

CP001736_1107: domain 1 of 1, from 212 to 277: score 60.3, E = 3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHDs+g++L++++l++ +ar + ++e+ +al+ +
CP001736_1 212 ERLRLARELHDSIGHALAVASLHTNVARE----APNAEARSQALHLV 254

relarealaevRrllgdLRpaal<-*
r+ +ea++++R ++ LR +a
CP001736_1 255 RQSTSEAMTQLRSTVALLRSSAP 277

CP001736_2065: domain 1 of 1, from 169 to 236: score 58.4, E = 1.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ RE HD+v++sL++i+l +++a++++ + d+e++ ++l ++
CP001736_2 169 ERLRLVREVHDVVSHSLTSITLSAGVAAHVA--PGDAERLSRELIRV 213

relarealaevRrllgdLRpaal<-*
++ +r+ala++R +lg+ R++
CP001736_2 214 EQSGRQALADLRIVLGAARDDNA 236

CP001736_4380: domain 1 of 1, from 183 to 249: score 55.6, E = 7.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++++++ + +++a+ +l ++ + re l ei
CP001736_4 183 ERLALARELHDLVAHHITGVVVRTQAAQVVL--ADG--QERELLGEI 225

relarealaevRrllgdLR.paal<-*
++++ eal+ vRrl+ LR+p++
CP001736_4 226 ERAGAEALSAVRRLVVMLRsPDQQ 249

CP001736_5634: domain 1 of 1, from 177 to 251: score 55.3, E = 9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.......ea
ER IA ELHD+++++L+++++q+++a++l+ d p +++ + +e+
CP001736_5 177 ERVLIAAELHDVLAHGLAVANVQASVAAHLI--DQLPRrgdasleEL 221

realdeirelarealaevRrllgdLRpaal<-*
+l+++ +++r +l e+R++l +L+ ++
CP001736_5 222 SSTLHNLSDTSRATLHELRAVLDVLHGGEA 251

CP001736_3384: domain 1 of 1, from 234 to 299: score 53.7, E = 2.6e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ERaRI R LHD+v Q+L ++++ l+la+ + pe+ ++ +
CP001736_3 234 ERARIERHLHDGVQQRLVGLTMTLGLAE-----LDLPEgDGKTLVVK 275

irelarealaevRrllgdLRpaal<-*
+++ a+ ala++R+++++++p +l
CP001736_3 276 AHREAEAALADLREAVRGIHPRVL 299

CP001736_3285: domain 1 of 1, from 185 to 251: score 51.5, E = 1.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA+++HDsvg+ Ls+i+l + +++ d + pe+ r+a++e+
CP001736_3 185 ERSRIAQDMHDSVGHELSLIALRAAALEV--D-SDLPERHRQAATEL 228

relarealaevRrllgdLRpaal<-*
re+a +a + + +++g+LR+a+
CP001736_3 229 REAAATATERLGEIIGVLRDAGT 251

CP001736_1283: domain 1 of 1, from 180 to 255: score 51.2, E = 1.5e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe........e
ER +ARELHD v++++++i + +++ar ++ + +++++++++
CP001736_1 180 ERVALARELHDFVAHHITGIVVLAQGARVVA--GRRRGggegdgpgS 224

arealdeirelarealaevRrllgdLRpaal<-*
a++ ++i++++ eal+ +Rr++g LR++
CP001736_1 225 AETVYQQIEQAGGEALTAMRRVVGMLRTDRS 255

CP001736_0797: domain 1 of 1, from 177 to 244: score 46.4, E = 3.7e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L ++kl++ la+++l ++dp +a+++l+ei
CP001736_0 177 ERVRFAGDLHDIQGHTLHVVKLKAALAQKIL--RSDPVQAEQELREI 221

relarealaevRrllgdLRpaal<-*
++l+ +++ ++ +l+ + R l
CP001736_0 222 HALVVDTIGQTKALAYGERRLNL 244

CP001736_4258: domain 1 of 1, from 189 to 255: score 44.7, E = 1.2e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD++g +L+++ l + ++ ++ d++ +++ a ++
CP001736_4 189 ERERLAVEIHDTLGRHLTLLVLRANTLTLMT--DDP--AVKLAGSQL 231

relarealaevRrllgdLR.paal<-*
+ ++ ala++Rrl++ L++p++
CP001736_4 232 SGFGSAALADLRRLVRLLHkPTDS 255

CP001736_1939: domain 1 of 1, from 173 to 241: score 38.7, E = 7.1e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IA +LHD +g+ L++i +q+++a+++ + + re+l++i
CP001736_1 173 QREEIAKDLHDYLGHDLTGILVQAQAALTID--NESASDHRETLTNI 217

relarealaevRrllgdLR.paal<-*
++ a +ala + r++ +L +p+a
CP001736_1 218 AADATHALATLDRVIATLFgPSAP 241


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-14 8 0|=
-13 46 1|*==
-12 90 77|====*
-11 175 636|========== *
-10 655 1476|===================================== *
-9 1038 1676|==========================================================*
-8 1029 1292|==========================================================*
-7 1060 812|=============================================*=============
-6 852 459|=========================*======================
-5 792 246|=============*==============================
-4 428 128|=======*================
-3 304 66|===*=============
-2 157 33|=*=======
-1 116 17|*======
0 62 8|*===
1 35 4|*=
2 24 2|*=
3 11 1|*
4 10 0|=
5 7 0|=
6 2 0|=
7 2 0|=
8 1 0|=
9 2 0|=
10 1 0|=
11 0 0|
12 0 0|
> 13 36 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5594.7236
P(chi-square) = 0

Total sequences searched: 6943

Whole sequence top hits:
tophits_s report:
Total hits: 32
Satisfying E cutoff: 32
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 32
Satisfying E cutoff: 32
Total memory: 32K


Acknowledgements:

This research is funded by:

Developed by: