Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Nakamurella multipartita DSM 44233  

Data for CP001737  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001737.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001737_2904 CDS_3295734-3296894 90.8 2.3e-26 1
CP001737_3278 CDS_3727279-3726071 85.8 6.9e-25 3
CP001737_4911 CDS_5663953-5665059 85.4 9.2e-25 1
CP001737_3920 CDS_4483762-4482611 85.2 1e-24 1
CP001737_0584 CDS_669355-670659 85.0 1.2e-24 1
CP001737_2545 CDS_2883781-2884812 83.1 4.2e-24 1
CP001737_0629 CDS_719682-718495 82.3 7.2e-24 1
CP001737_0523 CDS_607866-606718 81.3 1.4e-23 1
CP001737_0502 CDS_580563-581762 73.3 3.3e-21 1
CP001737_4446 CDS_5125270-5126481 67.6 1.6e-19 1
CP001737_2827 CDS_3202982-3204133 66.3 3.9e-19 1
CP001737_3724 CDS_4238712-4240016 64.5 1.3e-18 1
CP001737_3298 CDS_3746440-3748500 63.9 1.9e-18 1
CP001737_0460 CDS_528868-530541 57.0 2.1e-16 2
CP001737_0742 CDS_847112-845769 55.9 4.3e-16 1
CP001737_0784 CDS_898137-896395 54.6 1.1e-15 1
CP001737_2376 CDS_2694979-2696256 54.5 1.1e-15 2
CP001737_4575 CDS_5272761-5274368 48.9 5.2e-14 1
CP001737_1952 CDS_2212658-2214445 40.2 1.9e-11 1
CP001737_2552 CDS_2888843-2890204 34.0 1.2e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001737_2904 1/1 188 255 .. 1 70 [] 90.8 2.3e-26
CP001737_4911 1/1 141 205 .. 1 70 [] 85.4 9.2e-25
CP001737_3920 1/1 184 251 .. 1 70 [] 85.2 1e-24
CP001737_0584 1/1 207 274 .. 1 70 [] 85.0 1.2e-24
CP001737_2545 1/1 145 209 .. 1 70 [] 83.1 4.2e-24
CP001737_3278 1/3 188 255 .. 1 70 [] 83.1 4.2e-24
CP001737_0629 1/1 184 251 .. 1 70 [] 82.3 7.2e-24
CP001737_0523 1/1 181 248 .. 1 70 [] 81.3 1.4e-23
CP001737_0502 1/1 183 249 .. 1 70 [] 73.3 3.3e-21
CP001737_4446 1/1 200 265 .. 1 70 [] 67.6 1.6e-19
CP001737_2827 1/1 187 254 .. 1 70 [] 66.3 3.9e-19
CP001737_3724 1/1 242 309 .. 1 70 [] 64.5 1.3e-18
CP001737_3298 1/1 490 557 .. 1 70 [] 63.9 1.9e-18
CP001737_0742 1/1 218 288 .. 1 70 [] 55.9 4.3e-16
CP001737_0784 1/1 390 456 .. 1 70 [] 54.6 1.1e-15
CP001737_2376 2/2 221 288 .. 1 70 [] 54.3 1.4e-15
CP001737_4575 1/1 336 402 .. 1 70 [] 48.9 5.2e-14
CP001737_0460 2/2 361 416 .. 1 58 [. 47.9 1e-13
CP001737_1952 1/1 404 469 .. 1 70 [] 40.2 1.9e-11
CP001737_2552 1/1 249 316 .. 1 70 [] 34.0 1.2e-09

Alignments of top-scoring domains:
CP001737_2904: domain 1 of 1, from 188 to 255: score 90.8, E = 2.3e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD +g+sL+ai+++++larrl+ +d+++a+++++e+
CP001737_2 188 ERERIGRDLHDILGHSLTAIAIKAGLARRLI--GRDDDAAAAQVAEV 232

relarealaevRrllgdLRpaal<-*
++lareala+vR++++++R + l
CP001737_2 233 ETLAREALADVRATASGFRQMSL 255

CP001737_4911: domain 1 of 1, from 141 to 205: score 85.4, E = 9.2e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQsL+a+ l+l + + d +p+++re+l+ +
CP001737_4 141 ERQRIARELHDEIGQSLTAVLLGLKRTA-----DQAPAPLREELHDV 182

relarealaevRrllgdLRpaal<-*
+e++r +l+evR ++++LRp++l
CP001737_4 183 QETIRACLDEVRTVARRLRPGVL 205

CP001737_3920: domain 1 of 1, from 184 to 251: score 85.2, E = 1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR++HD+v++sL++++ q+++ar+++ ++dp++a +al++i
CP001737_3 184 ERVRIARDMHDVVAHSLAVVIAQADGARYAA--ATDPAAATAALTTI 228

relarealaevRrllgdLRpaal<-*
+ar ala+vR ll++LR+++
CP001737_3 229 GSTARSALADVRLLLTRLRHSQG 251

CP001737_0584: domain 1 of 1, from 207 to 274: score 85.0, E = 1.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD v++s + + l++ +arr++ ++dp++a+e l++i
CP001737_0 207 ERLRIARELHDIVAHSVTIMVLHAAGARRVV--RTDPDRAAESLTTI 251

relarealaevRrllgdLRpaal<-*
+e +++a++e+Rrll LR++++
CP001737_0 252 EESGQQAMTELRRLLALLRESDD 274

CP001737_2545: domain 1 of 1, from 145 to 209: score 83.1, E = 4.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI +ELHD++gQ+L++i lql ++r d pe+ar +l++i
CP001737_2 145 ERRRIGQELHDEIGQRLTGILLQLRGLR-----DGLPEQARPQLHQI 186

relarealaevRrllgdLRpaal<-*
+ +r +l+ev +l+++LRp++l
CP001737_2 187 QSEVRATLDEVGALAWQLRPGIL 209

CP001737_3278: domain 1 of 3, from 188 to 255: score 83.1, E = 4.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++++i++q+++a++ll + +pe+a+eal+ +
CP001737_3 188 ERLRIARELHDVVAHQIAVINVQSGVAEHLL--PVNPERAAEALRHV 232

relarealaevRrllgdLRpaal<-*
re++++ l+e+ llg+LR a+
CP001737_3 233 REASSQVLTEMGTLLGVLRGADS 255

CP001737_0629: domain 1 of 1, from 184 to 251: score 82.3, E = 7.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +++sL+ ++ +++a+ + ++dp++ar l+++
CP001737_0 184 ERNRIAREMHDIIAHSLAIMITLADAAAGKV--QTDPDRARGVLRQL 228

relarealaevRrllgdLRpaal<-*
++++r +l+e+R+l+g+LR++ l
CP001737_0 229 AGTGRATLDEARQLVGVLRTDPL 251

CP001737_0523: domain 1 of 1, from 181 to 248: score 81.3, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+v+++ s+i +q+++ r+++ +++pe+a eal+ i
CP001737_0 181 EREQLARELHDTVAHHVSGIVIQAQAGRAVA--ASHPEQAVEALAVI 225

relarealaevRrllgdLRpaal<-*
+++a ++l+e+R+++g+LR +++
CP001737_0 226 EDAATRTLTELRAIVGVLRASQD 248

CP001737_0502: domain 1 of 1, from 183 to 249: score 73.3, E = 3.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaRI+RELHD v+++ s+++lq++++r ++ p++++ +e l+
CP001737_0 183 ERARISRELHDAVAHTVSVMTLQAGVVR-----RRMPDgsPEQEMLR 224

eirelarealaevRrllgdLRpaal<-*
+++l+r++ +e+R+++g LR++
CP001737_0 225 SVEGLGRRSVDELRQVVGLLRTGPS 249

CP001737_4446: domain 1 of 1, from 200 to 265: score 67.6, E = 1.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ERaR+AR++HD+++Q+Ls+i + l++a+ ++dp ++ + +++
CP001737_4 200 ERARLARDIHDTLAQGLSSIQMLLQAAE-----RADPTgPSAGHVRL 241

irelarealaevRrllgdLRpaal<-*
+ ++ + lae+R l+++L pa l
CP001737_4 242 ALATTADNLAEARTLVRELTPAPL 265

CP001737_2827: domain 1 of 1, from 187 to 254: score 66.3, E = 3.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+la+ l+ ++dp++a+e ++++
CP001737_2 187 ELRRIERDLHDGAQAQLVALGMNLGLAQELV--TRDPAAAAELIEQA 231

relarealaevRrllgdLRpaal<-*
r+ + +ala++R l+++++p++l
CP001737_2 232 RASSTTALADLRSLVRGIHPPVL 254

CP001737_3724: domain 1 of 1, from 242 to 309: score 64.5, E = 1.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD+ Q+L ++++ l++ r+ + + p+ +r+a++ +
CP001737_3 242 ERRRLERDLHDGTQQRLVSLAMNLGMTRTTM--VDVPDHVRDAVTSA 286

relarealaevRrllgdLRpaal<-*
+e a+ alae+R+l+++L+pa+l
CP001737_3 287 HEEAKLALAELRDLVRGLHPAVL 309

CP001737_3298: domain 1 of 1, from 490 to 557: score 63.9, E = 1.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RI R+LHD++g L +++l l++a ++ ++dp++ r+ +++
CP001737_3 490 DRRRIRRDLHDGLGPVLGGVALRLDAAGNAI--AADPDRGRRLVAQS 534

relarealaevRrllgdLRpaal<-*
r+ + +ala+vRrl+++LRp+al
CP001737_3 535 RQDVTDALADVRRLVHGLRPPAL 557

CP001737_0742: domain 1 of 1, from 218 to 288: score 55.9, E = 4.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER+RIARELHDsv+Q ++ + +e+ar + ++ + + ++++l
CP001737_0 218 ERHRIARELHDSVSQFVLSAGMAVEMARGDA--ADLGPagaDLAKQL 262

deirelarealaevRrllgdLRpaal<-*
d++++l +ea++++R+++ +L++aa
CP001737_0 263 DRAKHLTQEAIQQLRDAIYALHHAAS 288

CP001737_0784: domain 1 of 1, from 390 to 456: score 54.6, E = 1.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD+ Q++ ++ + ++++ r++ d++ ++ +++i
CP001737_0 390 ERRRIARDLHDGPQQRIVLLGIEAQRIGRRA---GDADFVAPLAETI 433

relarealaevRrllgdLRpaal<-*
e +r+ l+++R+l++++ pa+l
CP001737_0 434 SEQLRHLLDDLRDLVHGIMPATL 456

CP001737_2376: domain 2 of 2, from 221 to 288: score 54.3, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+ l l+larr + d +p++ r++l ++
CP001737_2 221 ERRRIERDLHDGAQQQLIALGLALQLARRTA--DQAPDRCRQTLSAA 265

relarealaevRrllgdLRpaal<-*
++la+++ +e+ rl + L a+
CP001737_2 266 ADLAHRTAQELGRLSWSLYSAVT 288

CP001737_4575: domain 1 of 1, from 336 to 402: score 48.9, E = 5.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RI R+LHD v Q+L+a+ l le +r++ p+++++++d++
CP001737_4 336 DRDRIGRDLHDLVIQRLFAVGLTLENTARIA----GPGRIADRVDAA 378

relarealaevRrllgdLR.paal<-*
+ ++++++++Rr++ +L +p+
CP001737_4 379 VDQLDQTIKDIRRTIFELAnPDRP 402

CP001737_0460: domain 2 of 2, from 361 to 416: score 47.9, E = 1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ ARE+HD+v+++ +i++q+ +a+ + dp++ r+al i
CP001737_0 361 ERTAFAREIHDTVSHAVGLIAVQAAAAEVSW--PGDPAATRQALGVI 405

relarealaev<-*
+++a a a++
CP001737_0 406 AATATAAHADL 416

CP001737_1952: domain 1 of 1, from 404 to 469: score 40.2, E = 1.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+ai l+++ +r ++ + +++l+
CP001737_1 404 DRDRIARDLHDHVIQRLFAIGLGMQSTHR----REKSPHQAARLADH 446

relarealaevRrllgdLRpaal<-*
+ +++ ++e+R ++ dL+ +
CP001737_1 447 IDQLHDVIQEIRTAIFDLQAGPA 469

CP001737_2552: domain 1 of 1, from 249 to 316: score 34.0, E = 1.2e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R +HD+ Q+ a+ + l l+++ll + pe+ ++ l +
CP001737_2 249 ERQRLERNIHDGAQQQVIALLVNLRLIQTLL--GRSPERGARLLGQQ 293

relarealaevRrllgdLRpaal<-*
++are+ + + +l ++L p+ l
CP001737_2 294 VAAARESVDTLTALSSGLYPPML 316


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-14 7 0|=
-13 47 0|====
-12 74 58|====*=
-11 163 480|============ *
-10 466 1114|================================== *
-9 786 1265|========================================================= *
-8 781 975|======================================================== *
-7 775 613|===========================================*============
-6 596 347|========================*==================
-5 609 186|=============*==============================
-4 361 97|======*===================
-3 210 49|===*===========
-2 116 25|=*=======
-1 92 13|*======
0 55 6|*===
1 25 3|*=
2 22 1|*=
3 11 0|=
4 7 0|=
5 7 0|=
6 2 0|=
7 1 0|=
8 0 0|
9 2 0|=
10 0 0|
11 0 0|
12 1 0|=
13 0 0|
> 14 24 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4377.3623
P(chi-square) = 0

Total sequences searched: 5240

Whole sequence top hits:
tophits_s report:
Total hits: 20
Satisfying E cutoff: 20
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 20
Satisfying E cutoff: 20
Total memory: 27K


Acknowledgements:

This research is funded by:

Developed by: