Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Thermomonospora curvata DSM 43183  

Data for CP001738  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001738.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001738_2260 CDS_2690856-2689639 98.0 1.7e-28 1
CP001738_0110 CDS_118036-116918 97.6 2.2e-28 1
CP001738_4410 CDS_5094719-5093487 91.1 1.7e-26 1
CP001738_2891 CDS_3440132-3438915 86.3 4.5e-25 1
CP001738_2782 CDS_3319448-3318339 82.0 8.5e-24 1
CP001738_0151 CDS_164250-165227 81.6 1.1e-23 1
CP001738_1590 CDS_1889069-1890220 79.7 4.1e-23 1
CP001738_2706 CDS_3223714-3226074 75.7 6.3e-22 2
CP001738_3210 CDS_3790824-3792818 72.7 4.8e-21 1
CP001738_4640 CDS_5352329-5353618 72.4 5.8e-21 1
CP001738_1275 CDS_1484080-1482911 69.2 4.9e-20 1
CP001738_1619 CDS_1922461-1923582 67.1 2.1e-19 1
CP001738_3854 CDS_4478909-4477581 66.9 2.5e-19 1
CP001738_2189 CDS_2617376-2618575 63.6 2.2e-18 1
CP001738_2420 CDS_2869685-2870866 61.2 1.2e-17 1
CP001738_4572 CDS_5273682-5274890 60.9 1.4e-17 1
CP001738_1500 CDS_1761765-1760410 58.2 8.5e-17 1
CP001738_0489 CDS_563440-565155 56.9 2.1e-16 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001738_2260 1/1 196 264 .. 1 70 [] 98.0 1.7e-28
CP001738_0110 1/1 167 234 .. 1 70 [] 97.6 2.2e-28
CP001738_4410 1/1 204 271 .. 1 70 [] 91.1 1.7e-26
CP001738_2891 1/1 205 272 .. 1 70 [] 86.3 4.5e-25
CP001738_2782 1/1 167 234 .. 1 70 [] 82.0 8.5e-24
CP001738_0151 1/1 122 186 .. 1 70 [] 81.6 1.1e-23
CP001738_1590 1/1 183 250 .. 1 70 [] 79.7 4.1e-23
CP001738_3210 1/1 454 521 .. 1 70 [] 72.7 4.8e-21
CP001738_4640 1/1 232 299 .. 1 70 [] 72.4 5.8e-21
CP001738_1275 1/1 184 255 .. 1 70 [] 69.2 4.9e-20
CP001738_1619 1/1 166 234 .. 1 70 [] 67.1 2.1e-19
CP001738_3854 1/1 252 319 .. 1 70 [] 66.9 2.5e-19
CP001738_2189 1/1 188 255 .. 1 70 [] 63.6 2.2e-18
CP001738_2420 1/1 189 255 .. 1 70 [] 61.2 1.2e-17
CP001738_4572 1/1 211 277 .. 1 70 [] 60.9 1.4e-17
CP001738_1500 1/1 233 300 .. 1 70 [] 58.2 8.5e-17
CP001738_0489 1/1 376 442 .. 1 70 [] 56.9 2.1e-16
CP001738_2706 1/2 201 260 .. 1 62 [. 53.0 3.1e-15

Alignments of top-scoring domains:
CP001738_2260: domain 1 of 1, from 196 to 264: score 98.0, E = 1.7e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++++q+++arr+l d+ pe area+++i
CP001738_2 196 ERSRIARELHDVVAHHVSVMTVQAGAARRIL--DRSPESAREAMTTI 240

relarealaevRrllgdLR.paal<-*
+e +r+al+e+Rr++g+LR++ +
CP001738_2 241 EEVGRTALSEMRRIVGVLRtERDG 264

CP001738_0110: domain 1 of 1, from 167 to 234: score 97.6, E = 2.2e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+vg++Ls+i++q+ +a++++ kdp++a++al +i
CP001738_0 167 ERLRIARELHDVVGHHLSLINVQSAAALHRI--GKDPAQAKAALGAI 211

relarealaevRrllgdLRpaal<-*
+e +r+al+++R++lg+LR++++
CP001738_0 212 KESSRTALRDLRATLGVLRESGE 234

CP001738_4410: domain 1 of 1, from 204 to 271: score 91.1, E = 1.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s+i +q+++a +++ d+d e+a++al++i
CP001738_4 204 ERARIARELHDVVAHNVSVIVVQADGASYAI--DTDRERAKKALEAI 248

relarealaevRrllgdLRpaal<-*
+++r alae+Rrllg+LR+ ++
CP001738_4 249 SATGRLALAEMRRLLGVLREEDD 271

CP001738_2891: domain 1 of 1, from 205 to 272: score 86.3, E = 4.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g+sLs+i++++ela r++ ++dp++a+++++ +
CP001738_2 205 ERLRFARDLHDLLGHSLSLIAVKSELAIRMA--EADPARAKAEMADV 249

relarealaevRrllgdLRpaal<-*
r++ar+al+evR++++++R +l
CP001738_2 250 RQAARDALREVRAAVRGYRQVEL 272

CP001738_2782: domain 1 of 1, from 167 to 234: score 82.0, E = 8.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v+ + s++ ++++++++++ ++dpe+a+e+++ i
CP001738_2 167 ERARIAREMHDVVANRVSVMVVHASALKAIA--ARDPERAAETAAVI 211

relarealaevRrllgdLRpaal<-*
++++r+al+e+R+++g+LR ++
CP001738_2 212 ADMGRQALEELRQVIGVLRLGET 234

CP001738_0151: domain 1 of 1, from 122 to 186: score 81.6, E = 1.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD++gQsL+a+ l l ++ d+ pe++re ++ +
CP001738_0 122 ERRRIAQELHDEIGQSLTAVLLELKRLT-----DRVPEPLREDVRYA 163

relarealaevRrllgdLRpaal<-*
+e++r++l+evRr++++LRp++l
CP001738_0 164 QETIRDSLDEVRRIARRLRPGVL 186

CP001738_1590: domain 1 of 1, from 183 to 250: score 79.7, E = 4.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R AR+LHD++g+sL a++l +e+a+r l d+d +++r++l+ei
CP001738_1 183 ERQRFARDLHDVLGHSLQAVALRAEVAERYL--DRDVARVRKELTEI 227

relarealaevRrllgdLRpaal<-*
+++ar++ +vR++++++R + l
CP001738_1 228 QRMARDCVHDVREVVRGYRATSL 250

CP001738_3210: domain 1 of 1, from 454 to 521: score 72.7, E = 4.8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L+++++ +++ar l ++dp++++ l+++
CP001738_3 454 ERRRLRRDLHDGLGPTLASLAMTVDAARLTL--RRDPAAVDPLLERL 498

relarealaevRrllgdLRpaal<-*
r++ ++++a++R+l+ +LRp+al
CP001738_3 499 RTTMNQTIADIRELVYGLRPPAL 521

CP001738_4640: domain 1 of 1, from 232 to 299: score 72.4, E = 5.8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l+++++ll d+dp++ar+ l+e+
CP001738_4 232 ELRRIERDLHDGAQARLVAMGMSLGAIEHLL--DRDPQRARQLLAEV 276

relarealaevRrllgdLRpaal<-*
r+ + +al+e+R+l+++++p++l
CP001738_4 277 RRNSVQALNELRDLVRGIHPPVL 299

CP001738_1275: domain 1 of 1, from 184 to 255: score 69.2, E = 4.9e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpeeareald
ER +AR+LHD v+++ ++i +q+++ar ++s+ + pe++++ l+
CP001738_1 184 ERLALARDLHDFVAHHVTGIVVQAQAARFTARSgaAQSPEQLEAMLE 230

eirelarealaevRrllgdLRpaal<-*
i++++ eala +Rr++g LR++++
CP001738_1 231 SIERAGTEALASMRRMVGLLRDDGD 255

CP001738_1619: domain 1 of 1, from 166 to 234: score 67.1, E = 2.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ERaR+ R++HD+++Q+L+++ +l++++++l + + ea+++l
CP001738_1 166 ERARLVRDIHDGIAQRLASLGFHLSACEQAL--AQGATaEAQAQLGL 210

irelarealaevRrllgdLRpaal<-*
+rel++ a ae+R+++g+LRp++l
CP001738_1 211 ARELCDLAAAETRAAIGGLRPPVL 234

CP001738_3854: domain 1 of 1, from 252 to 319: score 66.9, E = 2.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ +++ar+ l ++dpe+ar+ ++++
CP001738_3 252 ERRRIERDLHDGAQQRLLAVAMDIGRARAKL--TSDPEAARALIEQA 296

relarealaevRrllgdLRpaal<-*
+e + a+ae+R+l++++ pa+l
CP001738_3 297 HEGTKAAIAELRDLARGIYPAIL 319

CP001738_2189: domain 1 of 1, from 188 to 255: score 63.6, E = 2.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+v+ +Lsa++l++ +++rl d d + + +a++ i
CP001738_2 188 ERARMARELHDVVAGHLSAVALHSAALLRLP--DMDRDSVHRAMTVI 232

relarealaevRrllgdLRpaal<-*
re + ++lae+Rr++g LR++
CP001738_2 233 RENSVQGLAEMRRMIGLLREGRR 255

CP001738_2420: domain 1 of 1, from 189 to 255: score 61.2, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD++++++s+++l++++++++ pe+ ++a++ i
CP001738_2 189 ERERLAREMHDVLAHRISLLALHAGALEYRG---NLPEAEQRAAQVI 232

relarealaevRrllgdLRpaal<-*
re a+eal+e+R++++ LR +a+
CP001738_2 233 RECAHEALEELREVIRMLRGGAE 255

CP001738_4572: domain 1 of 1, from 211 to 277: score 60.9, E = 1.4e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RI R+LHD+ Q+L +++lql++a+ + p++++a+e++
CP001738_4 211 ERRRIERDLHDGAQQRLLGLTLQLGMAL-----LDLPPgsPAAERVG 252

eirelarealaevRrllgdLRpaal<-*
e+++ are ++e+R+++++++p +l
CP001738_4 253 EAHRQARELMRELREVIRGIHPRVL 277

CP001738_1500: domain 1 of 1, from 233 to 300: score 58.2, E = 8.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ RELHD++g +L+++++ +++ar + ++ p++++ l e+
CP001738_1 233 ERRRLRRELHDGLGPTLASLAMSVDVARLTI--ARTPARVEPLLCEL 277

relarealaevRrllgdLRpaal<-*
r+ ++ a+ ++R+l+ +LRp+al
CP001738_1 278 RRRLDAAIGDIRDLVEGLRPPAL 300

CP001738_0489: domain 1 of 1, from 376 to 442: score 56.9, E = 2.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIA +LHD+v Q+L+a ++ l a++l+ d++ a+++++++
CP001738_0 376 DRDRIAKDLHDTVIQRLFATAMTLMSAAKLI--DRP--DAQARVRRA 418

relarealaevRrllgdLR.paal<-*
+ ++++++++R ++ +L++p+++
CP001738_0 419 VDDLDDTIRQIRSTIFALQtPPDE 442

CP001738_2706: domain 1 of 2, from 201 to 260: score 53.0, E = 3.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R R AR+ HD +g +Lsa+ l++ela+rl+ +p++a+++l+ei
CP001738_2 201 DRLRFARDVHDLLGSGLSALVLKSELAHRLI--VPNPARAARELAEI 245

relarealaevRrll<-*
+++r+ala++R ++
CP001738_2 246 LDIGRRALADARSVA 260


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-14 10 0|=
-13 35 0|===
-12 77 54|====*==
-11 108 448|========= *
-10 367 1039|=============================== *
-9 615 1180|==================================================== *
-8 612 910|=================================================== *
-7 682 572|===============================================*=========
-6 641 323|==========================*===========================
-5 682 173|==============*==========================================
-4 343 90|=======*=====================
-3 254 46|===*==================
-2 159 23|=*============
-1 113 12|*=========
0 62 6|*=====
1 43 3|*===
2 23 1|*=
3 18 0|==
4 9 0|=
5 6 0|=
6 4 0|=
7 2 0|=
8 1 0|=
9 0 0|
10 1 0|=
11 1 0|=
> 12 22 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 6625.9692
P(chi-square) = 0

Total sequences searched: 4890

Whole sequence top hits:
tophits_s report:
Total hits: 18
Satisfying E cutoff: 18
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 18
Satisfying E cutoff: 18
Total memory: 27K


Acknowledgements:

This research is funded by:

Developed by: