Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

9 accessions found for Spirosoma linguale DSM 74  

Data for CP001769  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP001769.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001769_0147 CDS_193938-197399 125.7 4.4e-35 2
CP001769_1725 CDS_2108358-2112581 102.3 1.9e-28 1
CP001769_3249 CDS_4006804-4010484 100.0 8.8e-28 1
CP001769_6444 CDS_7961246-7963837 99.4 1.2e-27 1
CP001769_0137 CDS_172988-175324 92.8 9.4e-26 1
CP001769_0611 CDS_782005-778076 92.7 1e-25 1
CP001769_2452 CDS_3030478-3028124 89.8 6.6e-25 1
CP001769_1012 CDS_1260872-1257267 87.9 2.3e-24 1
CP001769_6155 CDS_7611626-7608768 84.0 3e-23 1
CP001769_2016 CDS_2477230-2474510 83.5 4.2e-23 1
CP001769_1008 CDS_1255179-1251784 81.3 1.7e-22 1
CP001769_3079 CDS_3812466-3809647 72.2 6.6e-20 1
CP001769_1706 CDS_2087713-2083682 69.1 4.9e-19 1
CP001769_2918 CDS_3600345-3604280 68.8 5.9e-19 1
CP001769_0373 CDS_484613-486853 68.2 9.1e-19 1
CP001769_0899 CDS_1097432-1100749 67.9 1.1e-18 1
CP001769_2434 CDS_3013158-3011674 66.6 2.6e-18 1
CP001769_2869 CDS_3538022-3539428 65.1 6.8e-18 1
CP001769_2702 CDS_3337593-3335554 64.8 8.2e-18 1
CP001769_3487 CDS_4288225-4286600 64.5 1e-17 1
CP001769_4109 CDS_5055258-5058815 63.6 1.7e-17 1
CP001769_1864 CDS_2290019-2288085 62.1 4.7e-17 1
CP001769_5501 CDS_6828292-6827258 61.9 5.5e-17 1
CP001769_1876 CDS_2306277-2304271 61.0 9.5e-17 1
CP001769_0067 CDS_85393-87207 60.7 1.2e-16 2
CP001769_0502 CDS_632521-631610 59.7 2.3e-16 1
CP001769_4508 CDS_5586790-5588781 59.3 3e-16 1
CP001769_6319 CDS_7801910-7806166 57.8 7.6e-16 1
CP001769_2733 CDS_3372974-3375766 57.0 1.3e-15 1
CP001769_4229 CDS_5237742-5233675 55.7 3e-15 1
CP001769_0585 CDS_738115-740373 55.3 4.1e-15 1
CP001769_3642 CDS_4477376-4476060 55.0 4.8e-15 1
CP001769_5935 CDS_7335264-7337297 54.9 5.4e-15 1
CP001769_5512 CDS_6842801-6846577 54.7 6.1e-15 1
CP001769_0540 CDS_675396-679562 54.6 6.3e-15 1
CP001769_1246 CDS_1555225-1556442 54.3 7.7e-15 1
CP001769_0898 CDS_1095802-1097247 54.0 9.5e-15 1
CP001769_0376 CDS_489923-487899 53.8 1e-14 1
CP001769_2821 CDS_3482843-3481257 53.5 1.3e-14 1
CP001769_3969 CDS_4873516-4874883 53.2 1.6e-14 1
CP001769_0720 CDS_887283-885916 53.2 1.6e-14 1
CP001769_0784 CDS_964804-962069 52.9 1.9e-14 1
CP001769_1821 CDS_2233508-2234884 52.5 2.6e-14 1
CP001769_0135 CDS_168476-171676 51.2 5.7e-14 1
CP001769_4698 CDS_5846892-5848256 51.1 6.1e-14 1
CP001769_2068 CDS_2545026-2549075 51.1 6.1e-14 1
CP001769_3328 CDS_4102382-4104568 51.1 6.3e-14 1
CP001769_3387 CDS_4186115-4184778 50.9 7.1e-14 1
CP001769_5281 CDS_6549851-6547896 50.7 7.8e-14 1
CP001769_3745 CDS_4599277-4600704 50.4 9.6e-14 1
CP001769_0138 CDS_175822-179358 50.0 1.3e-13 1
CP001769_0097 CDS_116280-118520 48.7 3e-13 1
CP001769_4230 CDS_5238238-5241147 48.1 4.3e-13 1
CP001769_6416 CDS_7932185-7930275 48.0 4.6e-13 1
CP001769_3833 CDS_4698301-4700352 47.8 5.3e-13 1
CP001769_1965 CDS_2408458-2407295 47.3 7.2e-13 1
CP001769_2120 CDS_2629788-2632274 47.2 8e-13 1
CP001769_2127 CDS_2637954-2639516 47.1 8.6e-13 1
CP001769_0456 CDS_581870-583138 46.8 1e-12 1
CP001769_1016 CDS_1263944-1267723 46.5 1.2e-12 1
CP001769_3037 CDS_3759585-3761306 46.4 1.3e-12 1
CP001769_3136 CDS_3875866-3873044 45.9 1.9e-12 1
CP001769_3039 CDS_3766384-3762128 45.8 2e-12 1
CP001769_1852 CDS_2276786-2275479 45.4 2.5e-12 1
CP001769_3738 CDS_4587925-4590570 45.4 2.5e-12 1
CP001769_0608 CDS_773374-768920 45.4 2.6e-12 1
CP001769_0743 CDS_919331-920809 44.9 3.6e-12 1
CP001769_3655 CDS_4495520-4498456 44.4 5e-12 1
CP001769_2598 CDS_3216634-3217374 43.4 9.6e-12 1
CP001769_6481 CDS_8016055-8013626 42.8 1.4e-11 1
CP001769_2562 CDS_3164804-3163416 42.4 1.8e-11 1
CP001769_2735 CDS_3379132-3376829 41.8 2.7e-11 1
CP001769_1649 CDS_2014724-2012079 41.4 3.6e-11 1
CP001769_3641 CDS_4473740-4475881 41.4 3.6e-11 1
CP001769_4460 CDS_5520859-5522136 41.3 3.8e-11 1
CP001769_1006 CDS_1250864-1249749 41.2 4e-11 1
CP001769_2883 CDS_3555657-3557012 40.9 4.7e-11 1
CP001769_2032 CDS_2494171-2492363 40.9 4.8e-11 1
CP001769_5118 CDS_6372127-6373443 40.4 6.9e-11 1
CP001769_2050 CDS_2516652-2515066 39.5 1.2e-10 1
CP001769_2148 CDS_2668554-2666518 38.3 2.6e-10 1
CP001769_1018 CDS_1268877-1273097 37.6 4.2e-10 1
CP001769_1632 CDS_1996988-1993857 37.1 5.8e-10 1
CP001769_1206 CDS_1502886-1501588 36.5 8.5e-10 1
CP001769_2201 CDS_2726726-2729215 35.2 1.9e-09 1
CP001769_1155 CDS_1436865-1440383 34.4 3.4e-09 1
CP001769_4503 CDS_5582463-5579374 34.1 4.1e-09 1
CP001769_0099 CDS_118980-122162 32.4 1.2e-08 1
CP001769_3232 CDS_3985960-3980636 31.7 2e-08 1
CP001769_2661 CDS_3290786-3289314 31.2 2.6e-08 1
CP001769_3144 CDS_3885157-3886200 29.5 8.2e-08 2
CP001769_4927 CDS_6122759-6121386 28.7 1.4e-07 1
CP001769_2957 CDS_3658574-3654726 28.2 2e-07 1
CP001769_1013 CDS_1262485-1260902 27.3 3.5e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001769_1725 1/1 893 958 .. 1 87 [] 102.3 1.9e-28
CP001769_3249 1/1 714 779 .. 1 87 [] 100.0 8.8e-28
CP001769_6444 1/1 358 423 .. 1 87 [] 99.4 1.2e-27
CP001769_0137 1/1 138 203 .. 1 87 [] 92.8 9.4e-26
CP001769_0611 1/1 669 734 .. 1 87 [] 92.7 1e-25
CP001769_2452 1/1 312 378 .. 1 87 [] 89.8 6.6e-25
CP001769_1012 1/1 529 597 .. 1 87 [] 87.9 2.3e-24
CP001769_6155 1/1 453 518 .. 1 87 [] 84.0 3e-23
CP001769_2016 1/1 680 747 .. 1 87 [] 83.5 4.2e-23
CP001769_1008 1/1 454 522 .. 1 87 [] 81.3 1.7e-22
CP001769_0147 1/2 342 409 .. 1 87 [] 77.4 2.2e-21
CP001769_3079 1/1 443 508 .. 1 87 [] 72.2 6.6e-20
CP001769_1706 1/1 821 886 .. 1 87 [] 69.1 4.9e-19
CP001769_2918 1/1 801 867 .. 1 87 [] 68.8 5.9e-19
CP001769_0373 1/1 523 591 .. 1 87 [] 68.2 9.1e-19
CP001769_0899 1/1 864 936 .. 1 87 [] 67.9 1.1e-18
CP001769_2434 1/1 270 336 .. 1 87 [] 66.6 2.6e-18
CP001769_2869 1/1 226 292 .. 1 87 [] 65.1 6.8e-18
CP001769_2702 1/1 452 520 .. 1 87 [] 64.8 8.2e-18
CP001769_3487 1/1 312 380 .. 1 87 [] 64.5 1e-17
CP001769_4109 1/1 821 886 .. 1 87 [] 63.6 1.7e-17
CP001769_1864 1/1 423 492 .. 1 87 [] 62.1 4.7e-17
CP001769_5501 1/1 118 185 .. 1 87 [] 61.9 5.5e-17
CP001769_1876 1/1 140 206 .. 1 87 [] 61.0 9.5e-17
CP001769_0067 2/2 366 434 .. 1 87 [] 60.4 1.5e-16
CP001769_0502 1/1 69 137 .. 1 87 [] 59.7 2.3e-16
CP001769_4508 1/1 141 207 .. 1 87 [] 59.3 3e-16
CP001769_6319 1/1 880 947 .. 1 87 [] 57.8 7.6e-16
CP001769_2733 1/1 698 770 .. 1 87 [] 57.0 1.3e-15
CP001769_4229 1/1 837 903 .. 1 87 [] 55.7 3e-15
CP001769_0585 1/1 524 593 .. 1 87 [] 55.3 4.1e-15
CP001769_3642 1/1 218 286 .. 1 87 [] 55.0 4.8e-15
CP001769_5935 1/1 140 206 .. 1 87 [] 54.9 5.4e-15
CP001769_5512 1/1 1018 1089 .. 1 87 [] 54.7 6.1e-15
CP001769_0540 1/1 858 924 .. 1 87 [] 54.6 6.3e-15
CP001769_1246 1/1 179 247 .. 1 87 [] 54.3 7.7e-15
CP001769_0898 1/1 244 310 .. 1 87 [] 54.0 9.5e-15
CP001769_0376 1/1 440 508 .. 1 87 [] 53.8 1e-14
CP001769_2821 1/1 281 349 .. 1 87 [] 53.5 1.3e-14
CP001769_3969 1/1 232 298 .. 1 87 [] 53.2 1.6e-14
CP001769_0720 1/1 231 297 .. 1 87 [] 53.2 1.6e-14
CP001769_0784 1/1 671 739 .. 1 87 [] 52.9 1.9e-14
CP001769_1821 1/1 232 298 .. 1 87 [] 52.5 2.6e-14
CP001769_0135 1/1 840 912 .. 1 87 [] 51.2 5.7e-14
CP001769_4698 1/1 231 297 .. 1 87 [] 51.1 6.1e-14
CP001769_2068 1/1 828 893 .. 1 87 [] 51.1 6.1e-14
CP001769_3328 1/1 501 572 .. 1 87 [] 51.1 6.3e-14
CP001769_3387 1/1 221 287 .. 1 87 [] 50.9 7.1e-14
CP001769_5281 1/1 392 476 .. 1 87 [] 50.7 7.8e-14
CP001769_3745 1/1 252 324 .. 1 87 [] 50.4 9.6e-14
CP001769_0138 1/1 954 1026 .. 1 87 [] 50.0 1.3e-13
CP001769_0097 1/1 524 592 .. 1 87 [] 48.7 3e-13
CP001769_0147 2/2 910 977 .. 1 87 [] 48.4 3.7e-13
CP001769_4230 1/1 726 793 .. 1 87 [] 48.1 4.3e-13
CP001769_6416 1/1 400 467 .. 1 87 [] 48.0 4.6e-13
CP001769_3833 1/1 448 516 .. 1 87 [] 47.8 5.3e-13
CP001769_1965 1/1 151 219 .. 1 87 [] 47.3 7.2e-13
CP001769_2120 1/1 591 657 .. 1 87 [] 47.2 8e-13
CP001769_2127 1/1 287 354 .. 1 87 [] 47.1 8.6e-13
CP001769_0456 1/1 213 279 .. 1 87 [] 46.8 1e-12
CP001769_1016 1/1 1016 1087 .. 1 87 [] 46.5 1.2e-12
CP001769_3037 1/1 340 407 .. 1 87 [] 46.4 1.3e-12
CP001769_3136 1/1 421 488 .. 1 87 [] 45.9 1.9e-12
CP001769_3039 1/1 1189 1254 .. 1 87 [] 45.8 2e-12
CP001769_1852 1/1 201 268 .. 1 87 [] 45.4 2.5e-12
CP001769_3738 1/1 643 710 .. 1 87 [] 45.4 2.5e-12
CP001769_0608 1/1 1253 1324 .. 1 87 [] 45.4 2.6e-12
CP001769_0743 1/1 277 344 .. 1 87 [] 44.9 3.6e-12
CP001769_3655 1/1 740 807 .. 1 87 [] 44.4 5e-12
CP001769_2598 1/1 16 88 .. 1 87 [] 43.4 9.6e-12
CP001769_6481 1/1 576 643 .. 1 87 [] 42.8 1.4e-11
CP001769_2562 1/1 235 301 .. 1 87 [] 42.4 1.8e-11
CP001769_2735 1/1 529 596 .. 1 87 [] 41.8 2.7e-11
CP001769_1649 1/1 647 715 .. 1 87 [] 41.4 3.6e-11
CP001769_3641 1/1 475 542 .. 1 87 [] 41.4 3.6e-11
CP001769_4460 1/1 208 274 .. 1 87 [] 41.3 3.8e-11
CP001769_1006 1/1 153 223 .. 1 87 [] 41.2 4e-11
CP001769_2883 1/1 232 298 .. 1 87 [] 40.9 4.7e-11
CP001769_2032 1/1 366 434 .. 1 87 [] 40.9 4.8e-11
CP001769_5118 1/1 176 242 .. 1 87 [] 40.4 6.9e-11
CP001769_2050 1/1 39 111 .. 1 87 [] 39.5 1.2e-10
CP001769_2148 1/1 445 512 .. 1 87 [] 38.3 2.6e-10
CP001769_1018 1/1 1176 1249 .. 1 87 [] 37.6 4.2e-10
CP001769_1632 1/1 818 890 .. 1 87 [] 37.1 5.8e-10
CP001769_1206 1/1 176 242 .. 1 87 [] 36.5 8.5e-10
CP001769_2201 1/1 594 661 .. 1 87 [] 35.2 1.9e-09
CP001769_1155 1/1 934 1002 .. 1 87 [] 34.4 3.4e-09
CP001769_4503 1/1 793 852 .. 10 87 .] 34.1 4.1e-09
CP001769_0099 1/1 812 880 .. 1 87 [] 32.4 1.2e-08
CP001769_3232 1/1 1521 1605 .. 1 87 [] 31.7 2e-08
CP001769_2661 1/1 240 308 .. 1 87 [] 31.2 2.6e-08
CP001769_4927 1/1 210 294 .. 1 87 [] 28.7 1.4e-07
CP001769_2957 1/1 1046 1123 .. 1 87 [] 28.2 2e-07
CP001769_1013 1/1 289 356 .. 1 87 [] 27.3 3.5e-07

Alignments of top-scoring domains:
CP001769_1725: domain 1 of 1, from 893 to 958: score 102.3, E = 1.9e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fla++sHE+RTPL++++g++ lL++ t+lseeq
CP001769_1 893 AKSVFLATMSHEIRTPLNGVIGMTALLED---------TPLSEEQ-- 928

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
rey +ti++++e+ll ind+Ld+s+ie+g
CP001769_1 929 ----------REYAHTIRSCGESLLGVINDILDFSKIESG 958

CP001769_3249: domain 1 of 1, from 714 to 779: score 100.0, E = 8.8e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++flan+sHE+RTP+++++g+++lL + t+l+eeq
CP001769_3 714 VKEQFLANMSHEIRTPMNGVIGMIDLLND---------TKLDEEQ-- 749

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r y++t++r++e ll+++nd+Ldls+ieag
CP001769_3 750 ----------RSYVKTVKRSSETLLNILNDILDLSKIEAG 779

CP001769_6444: domain 1 of 1, from 358 to 423: score 99.4, E = 1.2e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++flan+sHE+RTPL+a++g++elL++ t+l+++q
CP001769_6 358 LKEDFLANMSHEIRTPLNAMLGFSELLET---------TNLDADQ-- 393

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l+ i+ +++ ll ++nd+Ld+s+ieag
CP001769_6 394 ----------QEFLRLIRTAGKNLLTIVNDILDISKIEAG 423

CP001769_0137: domain 1 of 1, from 138 to 203: score 92.8, E = 9.4e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fl+++sHE+RTPL++++g+++lLl+ t+ +e q
CP001769_0 138 AKSDFLSTMSHEIRTPLNGVIGFTDLLLK---------TKTDETQ-- 173

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ yl+ + ++a +ll++ind+Ld+s+ieag
CP001769_0 174 ----------HHYLSLVNQSATSLLDIINDILDFSKIEAG 203

CP001769_0611: domain 1 of 1, from 669 to 734: score 92.7, E = 1e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTPL++++g+++l l+ t+l++ q
CP001769_0 669 AKSEFLANMSHEIRTPLNGVIGFTDLVLK---------TTLTPTQ-- 704

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl ++ ++a+ ll ind+Ld+s+ieag
CP001769_0 705 ----------HQYLTIVNQSANALLTTINDILDFSKIEAG 734

CP001769_2452: domain 1 of 1, from 312 to 378: score 89.8, E = 6.6e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHELRTPL++I+gy++l ++ d++ls+ q
CP001769_2 312 AKSEFLANMSHELRTPLNGILGYTQLFKR--------DEALSPNQ-- 348

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++i+++ae ll Lind+Ldl++iea+
CP001769_2 349 ----------LKGVDIIHNCAENLLVLINDVLDLAKIEAQ 378

CP001769_1012: domain 1 of 1, from 529 to 597: score 87.9, E = 2.3e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++I++++ lL e+ + ++l+++q
CP001769_1 529 YKSEFLANMSHELRTPLNSILLLSRLLAENNE------ATLTPDQ-- 567

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey ++i+++++ ll Li+++Ldls+ieag
CP001769_1 568 ----------VEYARVIQSSGNGLLGLIDEILDLSKIEAG 597

CP001769_6155: domain 1 of 1, from 453 to 518: score 84.0, E = 3e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +f+an+sHE+RTPL+aI+g+++lL + t s++q
CP001769_6 453 AEKQFFANMSHEIRTPLNAIIGMSHLLYD---------TQPSAQQ-- 488

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
rey+++++ +a+ l +Li+dlLd+++ieag
CP001769_6 489 ----------REYINILKTSADFLHSLISDLLDMTKIEAG 518

CP001769_2016: domain 1 of 1, from 680 to 747: score 83.5, E = 4.2e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k++f++++ HE+RTPLt+Ir+++e+L + ++++e r
CP001769_2 680 QKDDFVSTVTHEIRTPLTSIRALSEILHD--------QADMDESMR- 717

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+l++++re+erl+rLin++Ldl+r ++g
CP001769_2 718 ----------QEFLSRVIRETERLSRLINQVLDLERYDSG 747

CP001769_1008: domain 1 of 1, from 454 to 522: score 81.3, E = 1.7e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks flan+sHELRTPL++++ +a+lL + + ++l+++q+
CP001769_1 454 YKSAFLANMSHELRTPLNSVLILAKLLAD------NKPDNLTAKQI- 493

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey +i+r+++ ll Lind+Ldl++ieag
CP001769_1 494 -----------EYATIIHRSGNDLLTLINDILDLAKIEAG 522

CP001769_0147: domain 1 of 2, from 342 to 409: score 77.4, E = 2.2e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ f+ n+sHE+RTPLt ++g +e Ll dt+l e +
CP001769_0 342 AKTAFFNNISHEFRTPLTLMLGPLEELLQ--------DTALQEST-- 378

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y++ +e +r a rll+L+n+lLd+srieag
CP001769_0 379 ---------YKQPIEATHRNALRLLKLVNNLLDFSRIEAG 409

CP001769_3079: domain 1 of 1, from 443 to 508: score 72.2, E = 6.6e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+ flan+sHE+RTP++aI+ + + + + t l+e q
CP001769_3 443 VKELFLANMSHEIRTPMNAILNLGQQITK---------TSLTEHQ-- 478

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ i +a ll +ind+Ld+s+ieag
CP001769_3 479 ----------QFFIGMINTAASNLLVIINDILDFSKIEAG 508

CP001769_1706: domain 1 of 1, from 821 to 886: score 69.1, E = 4.9e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+an+ HE+RTPLt I++ +e l+ + ++++
CP001769_1 821 VKSRFFANITHEFRTPLTLILTPLEQVLN---------ESADSPY-- 856

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ i+r a+rllrLin+lLdl++++ag
CP001769_1 857 ----------HNRLSLIYRNANRLLRLINELLDLAKLDAG 886

CP001769_2918: domain 1 of 1, from 801 to 867: score 68.8, E = 5.9e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+ n+ HE+RTPL+ I+ +e Ll +++ + ++
CP001769_2 801 LKTRFFDNITHEFRTPLSLILSPTEKLLS--------ESKHDGPT-- 837

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l ti+r + llrLin+lLdls++eag
CP001769_2 838 ----------RQALATIKRNGTLLLRLINQLLDLSKLEAG 867

CP001769_0373: domain 1 of 1, from 523 to 591: score 68.2, E = 9.1e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LRTPL++Ir yae+Llee+ ++ +++
CP001769_0 523 ELDAFSYTVSHDLRTPLSSIRCYAEILLEEYG------EDFTPDA-- 561

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++++++er++rLi+ +L +sr++
CP001769_0 562 ----------QALFQKVIDSTERMRRLIRHILYYSRMGRT 591

CP001769_0899: domain 1 of 1, from 864 to 936: score 67.9, E = 1.1e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sHE+RTPLt+I++ +el++ +l + ++ ++
CP001769_0 864 LKSQFVSTVSHEFRTPLTGISTSVELIQHYL-------RHVPDNLVP 903

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p+ + l+ i+r +++l++Li d L++s++eag
CP001769_0 904 PAI-------GRHLQAIIRKVQSLDELIGDTLTISKLEAG 936

CP001769_2434: domain 1 of 1, from 270 to 336: score 66.6, E = 2.6e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e++a++sH+LRTP+taI gya++L + +l+e++r
CP001769_2 270 IRRELVASISHDLRTPITAIHGYADALTT---------NTLPEDTR- 306

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y ++i + ++ l ++++l +l+++ea
CP001769_2 307 ----------HQYADVIAQGSKKLIIMVDELAELAKLEAR 336

CP001769_2869: domain 1 of 1, from 226 to 292: score 65.1, E = 6.8e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ f++++sHELRTPLt+++g +e+ + ++++ e+
CP001769_2 226 LQKSFVSHASHELRTPLTVMMGQIEVTRL---------QARTTEE-- 261

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y+ +++ +l+e++++ rL+n lL+l+r+ +
CP001769_2 262 ---------YEVAFDALLDEVKSMIRLVNGLLELARANSD 292

CP001769_2702: domain 1 of 1, from 452 to 520: score 64.8, E = 8.2e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+a++sHE+RTPLt+I+ a lL+ ++ t ++r
CP001769_2 452 LKGRFVAMASHEFRTPLTTILSSAGLLELYQ-------TSDQKDKR- 490

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++i++++++l+++++++L ++ +g
CP001769_2 491 ----------QKHIQRIRQAVKQLNSILEEFLSSDKLTEG 520

CP001769_3487: domain 1 of 1, from 312 to 380: score 64.5, E = 1e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHE+RTPLta+++ a l++++ +++ ++
CP001769_3 312 LKSRFVAMASHEFRTPLTAVLTSATLIEKYTT------SDQQDKR-- 350

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l +i+ ++++l+++++++L ++e+g
CP001769_3 351 ----------EKHLMRIRASVNHLNDILEEFLSVGKLEEG 380

CP001769_4109: domain 1 of 1, from 821 to 886: score 63.6, E = 1.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ fla+l+HELR+P+++Ir +++L + ++ qr
CP001769_4 821 RKDNFLAMLAHELRNPMATIRSGLQALNL----------AHTDAQR- 856

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + r++++l r+++dlLd ri g
CP001769_4 857 ----------QSTVAMMSRQTDHLVRMVDDLLDVNRITRG 886

CP001769_1864: domain 1 of 1, from 423 to 492: score 62.1, E = 4.7e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k +f++++sHE+RTPLt+I++ ++lL++ +a+ t++ + q
CP001769_1 423 LKVRFVSMASHEFRTPLTTILTSTSLLEK-----YAEITNQQDRQ-- 462

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +e+i+ ++++l+++++++L l+++++g
CP001769_1 463 ----------LKHIERIKIAVKHLNDILEEFLSLEKLQEG 492

CP001769_5501: domain 1 of 1, from 118 to 185: score 61.9, E = 5.5e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++efla++sHEL+TP+ a +g++++L + ++ ++e ++
CP001769_5 118 FRREFLADVSHELKTPIFAAQGFIHTLID---------GAVDDERVR 155

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++l+++ ++++ l++L+ dl ls++e+g
CP001769_5 156 ----------DKFLSKAAKSLDGLDALVKDLVALSQLETG 185

CP001769_1876: domain 1 of 1, from 140 to 206: score 61.0, E = 9.5e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+ n+ HELRTPLt I+ ++ L ++ +++++
CP001769_1 140 LKTRFFDNITHELRTPLTLILSPIQQLIQRY--------PAPPDL-- 176

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ ++r +++ll+Lin+lLdl+++e+g
CP001769_1 177 ----------SNGLRNVERHGQQLLQLINQLLDLAKMESG 206

CP001769_0067: domain 2 of 2, from 366 to 434: score 60.4, E = 1.5e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ f+a++sHEL+TPL++ ++ ++lL++ + + l++eq
CP001769_0 366 AKTNFIATISHELKTPLSSSKMSLKLLED------SRIGQLNDEQ-- 404

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++++i ++++rll+L +lL +++ e+g
CP001769_0 405 ----------KSLVSSIGDDINRLLNLTGELLNMAQVESG 434

CP001769_0502: domain 1 of 1, from 69 to 137: score 59.7, E = 2.3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +e l ++ HE+ TP+taIr++a++L ++ + +e +
CP001769_0 69 METEVLHSIVHEFQTPVTAIRMAADILTS------PIARNHPERT-- 107

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+y+++il+e+erl+++++ +L+l+r++ +
CP001769_0 108 ----------DKYVRIILEETERLQHQVETMLTLARADRN 137

CP001769_4508: domain 1 of 1, from 141 to 207: score 59.3, E = 3e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+ f+ n+ HE+RTPLt I++ +e Ll+ +++e q
CP001769_4 141 LKTHFFDNITHEFRTPLTLILAPVERLLR-------QWSEHQGTQ-- 178

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l i+r a++llrLin+lLdl+++e g
CP001769_4 179 -----------RDLIAIDRNARQLLRLINQLLDLAKLEVG 207

CP001769_6319: domain 1 of 1, from 880 to 947: score 57.8, E = 7.6e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k +f+ n+sHELRTPLt I+g +e L + + q+
CP001769_6 880 TKLRFFTNVSHELRTPLTLILGPLEELAS--------AGSGPLYQA- 917

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + ++++++ ll+L+n+l+d+ + eag
CP001769_6 918 ----------KDKVMLMHQQTRKLLDLVNQLMDFRKVEAG 947

CP001769_2733: domain 1 of 1, from 698 to 770: score 57.0, E = 1.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sH++RTPL aI ael++ +++l+ ++
CP001769_2 698 LKSQFIATASHQFRTPLMAITSSAELIRY--------YSALPTGTLK 736

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p L + + e il+++ l++L d L+ls+ie+g
CP001769_2 737 PPL------FLKQAEAILKQVSWLEELMTDTLTLSKIEEG 770

CP001769_4229: domain 1 of 1, from 837 to 903: score 55.7, E = 3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k +f+ ++sHE+RTPL+ I+g +e L e
CP001769_4 837 LKLQFFTDVSHEFRTPLSLISGPVEELIL--------AKEVQGGV-- 873

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ +e ++r ++ ll+Li++l+++ ++e+g
CP001769_4 874 ----------RQKIEYVQRNTRKLLQLIDELMTFQKMEQG 903

CP001769_0585: domain 1 of 1, from 524 to 593: score 55.3, E = 4.1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHE+RTPL++++ +el+ l +++++ +
CP001769_0 524 LKSQFVATVSHEFRTPLATMQSSLELINYHLA------SAATPVPI- 563

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l++i++e+e +L++d+L s +e+g
CP001769_0 564 ----------SKHLRVIEQEIEKVTDLLSDFLSASALESG 593

CP001769_3642: domain 1 of 1, from 218 to 286: score 55.0, E = 4.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHE+RTPLt+I++ ++l +++ ++l + +
CP001769_3 218 LKSQFVAMASHEFRTPLTVIKTSVDLVEKYT-------EHLKDLPI- 256

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++i ++++l ++d+L + ++++g
CP001769_3 257 ----------QKHFDRIGIAINHLITTLEDFLLMGQLDEG 286

CP001769_5935: domain 1 of 1, from 140 to 206: score 54.9, E = 5.4e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f n+ HE+RTPLt I+ +e Ll ++ +e++
CP001769_5 140 LKTRFYDNITHEFRTPLTLILSPVEKLLQ---------KHREPEEL- 176

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ ++r a++llrL+n+lLdl+++e+g
CP001769_5 177 ----------LMGLNMVERNAQQLLRLVNQLLDLAKLESG 206

CP001769_5512: domain 1 of 1, from 1018 to 1089: score 54.7, E = 6.1e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sHE+RTP+t+I+ +el++ +ld +++++
CP001769_5 1018 LKSQFVSTASHEFRTPMTTIQSSVELIKLYLD-----APAATARAS- 1058

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ l +i++++ + ++L+ d+L++ +ieag
CP001769_5 1059 ---------IQKHLGVIEKQIAQFSSLLTDVLTIGQIEAG 1089

CP001769_0540: domain 1 of 1, from 858 to 924: score 54.6, E = 6.3e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k f+ ++HE+RTPLt +++ +e+L +++ t+ + q
CP001769_0 858 TKLNFFTEIAHEIRTPLTLVMAPIEVLANQY-------TADTLIQ-- 895

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++++++rllrL+n+lLd+ + e+
CP001769_0 896 -----------KQVSIMRNSTDRLLRLLNQLLDFRKHETS 924

CP001769_1246: domain 1 of 1, from 179 to 247: score 54.3, E = 7.7e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sHE+RTPL+aI++ a+l ++ + e+ e+
CP001769_1 179 LKSRFVSMASHEFRTPLSAILTSASLVEK------YPRVEQQEKR-- 217

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++i+ ++++l+++++++L r+e+g
CP001769_1 218 ----------LRHIQRIRMSVNHLNDILEEFLSVGRLEEG 247

CP001769_0898: domain 1 of 1, from 244 to 310: score 54.0, E = 9.5e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+a++sHELRTPLt ++g++++ l+ ++ e
CP001769_0 244 SQRQFVAHASHELRTPLTNLLGTLDTSLT---------YDREVEA-- 279

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yr e++++e++ +L n lL l++i+++
CP001769_0 280 ---------YRLSMESAIDEVRKVIHLTNSLLSLAKIGSE 310

CP001769_0376: domain 1 of 1, from 440 to 508: score 53.8, E = 1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I++++++L++++ + ls+ +
CP001769_0 440 NLQQFAHIASHDLQEPLRRIQAFSDILQNQF------VDSLSDGE-- 478

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+++++i+++a+r++ Li dlL +s+ ++
CP001769_0 479 ----------RDMVRRIQKSAQRMQMLIKDLLLYSQVSTQ 508

CP001769_2821: domain 1 of 1, from 281 to 349: score 53.5, E = 1.3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+ +sH+L PL I+++ ++L+e++ ++ l++e
CP001769_2 281 DLQSFAYIASHDLQEPLRKIQAFGDILKEQY------SPLLDAEG-- 319

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++++++++aer+++Li+dlLd+sri ++
CP001769_2 320 ----------QYMIDRMQSAAERMSSLIRDLLDYSRIASQ 349

CP001769_3969: domain 1 of 1, from 232 to 298: score 53.2, E = 1.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f++++sHELRTPL+a++ ++l l+ +ls e +
CP001769_3 232 QQRSFVSHASHELRTPLAALKSEIQLGLR---------RPLSVERH- 268

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+l+ +l +++rl +L n lL l+r ++
CP001769_3 269 ----------TEILQNLLTDTDRLIALSNSLLVLARTLEN 298

CP001769_0720: domain 1 of 1, from 231 to 297: score 53.2, E = 1.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f++++sHELRTPLtaI g +e++l + + +++
CP001769_0 231 QQRTFVSHASHELRTPLTAITGQLEVALL---------AGDDLDEL- 267

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++++l++++ l+rL n lL l+
CP001769_0 268 ----------RATVQSVLEDVRDLNRLTNGLLSLANVSVD 297

CP001769_0784: domain 1 of 1, from 671 to 739: score 52.9, E = 1.9e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + lL +++ ++l +e+
CP001769_0 671 NLEQFAYIASHDLQEPLRKIQSFGNLLIDQY-------GNLLPEDG- 709

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l++++++aer+++Li+dlL +sr+ ++
CP001769_0 710 ----------RVMLRRMQSAAERMSQLIRDLLAYSRLSSE 739

CP001769_1821: domain 1 of 1, from 232 to 298: score 52.5, E = 2.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f++++sHELRTPLta++ ++l l + ls+e+
CP001769_1 232 QQRSFVSHASHELRTPLTALKSEIQLGLL---------QRLSPEE-- 267

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y+ +l+ +l ++++l +L n lL l+r ++
CP001769_1 268 ---------YEAILQNLLTDTDQLIALSNSLLSLARTLEN 298

CP001769_0135: domain 1 of 1, from 840 to 912: score 51.2, E = 5.7e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++f+ ++sHE+RTPL++I+ +el++ ++d +++se +l
CP001769_0 840 LKTQFITTASHEFRTPLASIISSVELIKYYAD-----LEDRSEANTL 881

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + +i +++ l +Li d L+ls++e+g
CP001769_0 882 ---------INRHVLSISKQVMALTDLIADTLTLSKLEEG 912

CP001769_4698: domain 1 of 1, from 231 to 297: score 51.1, E = 6.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+an+sHEL++PLt I+ +e+ l + +e
CP001769_4 231 LQRMFVANVSHELKNPLTQISSQLEVSLL---------NRREPEA-- 266

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yr+ ++++l++++ l L +lL+ls+ +
CP001769_4 267 ---------YRQTIRSVLDDVRELAGLTHELLQLSQVNQD 297

CP001769_2068: domain 1 of 1, from 828 to 893: score 51.1, E = 6.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak +f+ n++HE+RTPLt + ++ L + t+++ee
CP001769_2 828 AKLQFFINIAHEIRTPLTLVVSPLQKLIT---------TDQNEER-- 863

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ r ++r+l+L+n+l+d+ +ie g
CP001769_2 864 ----------GHLYDIMGRNTKRILDLVNQLMDIRKIEKG 893

CP001769_3328: domain 1 of 1, from 501 to 572: score 51.1, E = 6.3e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks f++++sH+++TPL+++++ ++l+ ++l + +++s+ +
CP001769_3 501 LKSMFVSMVSHQFKTPLSTMQTSVDLINNYL----QVPSDKSSSSI- 542

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l++i++e++ ++Lind+L l + eag
CP001769_3 543 ----------HRHLNIIQNEIKKYNNLINDMLILGKVEAG 572

CP001769_3387: domain 1 of 1, from 221 to 287: score 50.9, E = 7.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+ +++HELRTPLt +++ +e+ l+ e+ +e +
CP001769_3 221 LQRNFFGAAAHELRTPLTIMKTGLEVTLD---------NERVDESL- 257

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +l l+e+ rl+rL++++L+lsr e
CP001769_3 258 ----------KPFLAGQLDEVSRLSRLLDEFLTLSRPEDT 287

CP001769_5281: domain 1 of 1, from 392 to 476: score 50.7, E = 7.8e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldk........v.lagd
k++f+ n+ HE++TP+++I++++e+++e++ +++ ++++ ++++
CP001769_5 392 IKNDFINNMTHEFKTPISTISLAVEMAQEQMSAgrgawnkeLvSGSS 438

telseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<
++ + + +y +i++e++rl + ++ +L+++ ++ g
CP001769_5 439 GDELAGRL-----------SRYMGIIRDETRRLGSHVEKVLQMALLDRG 476

-*

CP001769_5 - -

CP001769_3745: domain 1 of 1, from 252 to 324: score 50.4, E = 9.6e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+a++sHE++TPLtaI+ +el + +l++ t+ ++
CP001769_3 252 LKSQFIATASHEFKTPLTAISSSVELVRYYLNR--EPQTPFTAVL-- 294

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l+ i + + l++Li d L+ls++++g
CP001769_3 295 ----------TKHLNAISDRTTGLDELIMDTLTLSKLDEG 324

CP001769_0138: domain 1 of 1, from 954 to 1026: score 50.0, E = 1.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f+ ++sHE+RTPL +I+ +el + ++ a+++ ++ +
CP001769_0 954 LKSQFITTASHEFRTPLMGISSSTELVKHYM----AREDIRPVLPI- 995

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + l il + +l++Li d L+ls+ie+g
CP001769_0 996 ---------INKHLTAILTKVASLNELIGDTLTLSKIEQG 1026

CP001769_0097: domain 1 of 1, from 524 to 592: score 48.7, E = 3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LR PL++I+ y+e+ +e++ +++ +e++
CP001769_0 524 ELEAFSYTVSHDLRSPLSSIKRYTEIYQEDY-------GDQMDETA- 562

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r ++++i ++++r++ Li++++++s+ ++
CP001769_0 563 ----------RGIFDRITKASDRMSMLIRNIMQYSQVGSS 592

CP001769_0147: domain 2 of 2, from 910 to 977: score 48.4, E = 3.7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL++++ ++l+e
CP001769_0 910 NLQQFAYVASHDLQEPLRKIQSFGDLLKNQYA------DNLGEGI-- 948

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+yl++++ +a+r++ Li+dlL +sri +
CP001769_0 949 -----------DYLKRMQTAANRMSTLIRDLLSFSRITTR 977

CP001769_4230: domain 1 of 1, from 726 to 793: score 48.1, E = 4.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + lL++++ +++ e
CP001769_4 726 NLQQFAYVASHDLQEPLRKIQSFGNLLQNQY-------ADQLGEG-- 763

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++++a r++ Li+dlL +sri +
CP001769_4 764 ----------GAYLERMQSAASRMSTLIRDLLSYSRISVQ 793

CP001769_6416: domain 1 of 1, from 400 to 467: score 48.0, E = 4.6e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+a +sH+L PL I+ + ++Ll+++ ++l++
CP001769_6 400 SLDQFAAVASHDLQEPLRKIKSFGDILLDQYA------PNLGDGV-- 438

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+l++++++a+r++ Li+ lL +sr+ ++
CP001769_6 439 -----------GLLSRMQSAADRMQTLIRSLLAYSRLSQE 467

CP001769_3833: domain 1 of 1, from 448 to 516: score 47.8, E = 5.3e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ +++lL+ ++ ++ s+++
CP001769_3 448 NLEKFAYVASHDLQEPLRKIQQFSDLLRIQY-------GNTSSKEE- 486

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+i+++a+r++ Li+dlL +sri +
CP001769_3 487 ----------LTYLERIQSAARRMSTLIRDLLSFSRISTR 516

CP001769_1965: domain 1 of 1, from 151 to 219: score 47.3, E = 7.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+ +sH+L PL +I y+ lL+ + ++l+ +
CP001769_1 151 ELQQFAYIASHDLQSPLKTIVNYLTLLES------KHGEKLDTDA-- 189

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++ +aer++ LindlLd+sr ++
CP001769_1 190 ----------VRLINVSTAAAERMRVLINDLLDFSRVGTD 219

CP001769_2120: domain 1 of 1, from 591 to 657: score 47.2, E = 8e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL+ + ++ see
CP001769_2 591 NLEQFAYIASHDLQEPLRKIQQFGDLLKS-------HVPPSSEEN-- 628

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++ +a r++rLi dlL +sri g
CP001769_2 629 -----------AYLERMQAAASRMSRLIKDLLAFSRIAMG 657

CP001769_2127: domain 1 of 1, from 287 to 354: score 47.1, E = 8.6e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ef+ +sH+L PL I+ + +lL ++ +++ +
CP001769_2 287 SLQEFAYVASHDLQEPLRKIQSFGDLLASQY-------ADALGDG-- 324

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y+++++ +a r++ Li+dlLd+sr+ +
CP001769_2 325 ----------AAYVHRMQTAATRMSVLIRDLLDYSRLSTR 354

CP001769_0456: domain 1 of 1, from 213 to 279: score 46.8, E = 1e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ ef+ n+sHE+ TPL+ I + +e L ++ l+e q
CP001769_0 213 SLKEFTENASHEMQTPLALINAKVEQLIQ--------SEQLTETQ-- 249

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e+i+++++r++rL + lL l++ie+
CP001769_0 250 ----------THWIERIYQASRRISRLNQGLLLLAKIENR 279

CP001769_1016: domain 1 of 1, from 1016 to 1087: score 46.5, E = 1.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sHE+RTPLt+I+ ++l++ +++ +++++ +
CP001769_1 1016 LKSQFVSTASHEFRTPLTTIQSSVDLIKF-----YLKLPTATASKS- 1056

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l++i +e+++ L++++L++ i+ag
CP001769_1 1057 ---------IHHHLDVIGKEIDQFGTLLSNILTIGTIDAG 1087

CP001769_3037: domain 1 of 1, from 340 to 407: score 46.4, E = 1.3e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f++ +sH+L PL ++ + ++L++++ +++ e
CP001769_3 340 DLQQFASIASHDLQEPLRKVQSFGDILRDQY-------SDQLGEG-- 377

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yl +++++a r++ Li dlL +sri +g
CP001769_3 378 ----------VYYLLRMQNAATRMSVLIKDLLSFSRISTG 407

CP001769_3136: domain 1 of 1, from 421 to 488: score 45.9, E = 1.9e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k +f +++sHE++TPL+ I++ +e Ll+ + s+ ++
CP001769_3 421 EKLRFYSYISHEFNTPLSLILTPTEDLLT--------KKTVSSHDL- 458

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l i++ a rllrLi+++Ldl + +ag
CP001769_3 459 ----------KSNLALIQKNAYRLLRLIDQMLDLRKTDAG 488

CP001769_3039: domain 1 of 1, from 1189 to 1254: score 45.8, E = 2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++efl++ sH+LR +I+g+a lL + e+r
CP001769_3 1189 ERGEFLRATSHDLRGSFGVIQGAAALLNL----------MDTKEER- 1224

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l+ + r + + +L+ +lLd+sr+eag
CP001769_3 1225 ----------EQMLSMLNRNLGQVTSLLTQLLDYSRLEAG 1254

CP001769_1852: domain 1 of 1, from 201 to 268: score 45.4, E = 2.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL ++ + +lL++++ + + +
CP001769_1 201 NLQQFAYVASHDLQEPLRKVQQFGDLLKNRY-------AGQLGDG-- 238

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++++a r++ Li+dlL +sri ++
CP001769_1 239 ----------VNYLERMQSAASRMSTLIRDLLSFSRISTQ 268

CP001769_3738: domain 1 of 1, from 643 to 710: score 45.4, E = 2.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH++ PL I+ + +lL+ ++ +++ +
CP001769_3 643 NLEQFAYIASHDMQEPLRKIQQFGDLLKSQY-------GDRLGDG-- 680

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++ +a r+++Li+dlL +sri +
CP001769_3 681 ----------VAYLERMQTAASRMSALIRDLLAFSRISTT 710

CP001769_0608: domain 1 of 1, from 1253 to 1324: score 45.4, E = 2.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks f++++sH++RTPL +I+ +el++ ++ ++ ++++
CP001769_0 1253 LKSLFVSMASHQFRTPLMTIQSSSELIEFLVN------QDNTDQK-- 1291

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p +++ l++i+ e+ l +++ d+L l + ++g
CP001769_0 1292 -------PAVQRHLHRIKGEVGKLTNILADILLLGQSDSG 1324

CP001769_0743: domain 1 of 1, from 277 to 344: score 44.9, E = 3.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++ +++++HE R+PLt +++++e L++el ++ +e
CP001769_0 277 MTGKIARSIAHEVRNPLTNLSLALEQLKDEL-------DTDNEYV-- 314

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++i r ++r+ +Li ++L s+ +
CP001769_0 315 ----------TMFTDIIGRNVDRIGQLITEMLNSSKPRDL 344

CP001769_3655: domain 1 of 1, from 740 to 807: score 44.4, E = 5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL++++ ++ +
CP001769_3 740 NLEQFAYIASHDLQEPLRKIQQFGDLLKNQY-------GDHLGDG-- 777

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++ +a r++ Li+dlL +sri +
CP001769_3 778 ----------LAYLERMQTAASRMSVLIRDLLAFSRISTT 807

CP001769_2598: domain 1 of 1, from 16 to 88: score 43.4, E = 9.6e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks f++++sHELRTP+++I +el++ ++ ++++ q+
CP001769_2 16 KKSTFVRTASHELRTPISSIYSGLELIEL----LSENVSDKTLSQK- 57

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + + ++++rl+ Li+d+ +l++ +g
CP001769_2 58 ---------IGFFARQSCQQIKRLNTLISDISTLEKYNSG 88

CP001769_6481: domain 1 of 1, from 576 to 643: score 42.8, E = 1.4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL+e++ +e
CP001769_6 576 NLGQFAYVASHDLQEPLRKIQQFGDLLKEQY-------AETLGGG-- 613

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yl++++ +a r++ Li+dlL +sri +
CP001769_6 614 ----------VNYLDRMQAAAYRMSVLIRDLLAYSRISTR 643

CP001769_2562: domain 1 of 1, from 235 to 301: score 42.4, E = 1.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+a +sHELRTPLt+I+g +e+ +++++ +
CP001769_2 235 NQRSFIAQASHELRTPLTTIKGWLETSIL---------YDADADSL- 271

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + +e++ l +L n lL+l+ri++
CP001769_2 272 ----------KRGMAQAVKELDKLTALSNGLLQLARIDSV 301

CP001769_2735: domain 1 of 1, from 529 to 596: score 41.8, E = 2.7e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL+ ++ +++ ++ +
CP001769_2 529 NLEQFAYVASHDLQEPLRKIQQFGDLLKSQY-------GDRLDDGI- 567

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++ +a r++ Li dlL +sri +
CP001769_2 568 -----------AYLERMQTAATRMSVLIKDLLAFSRISTT 596

CP001769_1649: domain 1 of 1, from 647 to 715: score 41.4, E = 3.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I + ++Ll+ ++ t+l++
CP001769_1 647 YLQQFAYVASHDLQEPLRKIHSFGDMLLT------QHATALDATG-- 685

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l++ ++++ r++ Li +lLd+sr+ ++
CP001769_1 686 ----------QDLLRRQQNAVLRMQLLIKNLLDYSRLTTQ 715

CP001769_3641: domain 1 of 1, from 475 to 542: score 41.4, E = 3.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL+ ++ + + +
CP001769_3 475 NLEQFAYIASHDLQEPLRKIQQFGDLLQSQY-------GGQLGDG-- 512

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ le+++ +a r++ Li+dlL +sri +
CP001769_3 513 ----------AAHLERMQTAASRMSVLIRDLLAFSRISTT 542

CP001769_4460: domain 1 of 1, from 208 to 274: score 41.3, E = 3.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +f+ n+sHEL TPL++ ++ ++ Ll +++l+e +
CP001769_4 208 LQKQFAENASHELQTPLAVASAELDFLLQ--------SDHLTEND-- 244

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+++ +++ rl++L + lL l++ e++
CP001769_4 245 ----------YAHLQRATDALGRLSQLNRSLLLLTQVENN 274

CP001769_1006: domain 1 of 1, from 153 to 223: score 41.2, E = 4e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+ +++H+L+ PLt+++++++l + t+ s + ++
CP001769_1 153 QLEKFVYMVAHDLKSPLTGLLTLLHLVES---------TNESRPMQQ 190

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+eL + yl+ +++++ + + +i+ +L++sr
CP001769_1 191 DEL-------ANYLSYLKEAGYHQSTMISSILEYSRQSID 223

CP001769_2883: domain 1 of 1, from 232 to 298: score 40.9, E = 4.7e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+a++sHELRTPLt +g++e+ + ++++ +
CP001769_2 232 SQRSFVAHASHELRTPLTNTLGTLETSIR---------YDKNPAD-- 267

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+r+ ++ +e++ +L n lL l++ g
CP001769_2 268 ---------WRDSMVIAVEELKKVIALTNGLLGLAKVTDG 298

CP001769_2032: domain 1 of 1, from 366 to 434: score 40.9, E = 4.8e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+ +sH+L PL I ++ lL ++ +++l+e
CP001769_2 366 SLQSFAFVASHDLQEPLRKIESFSTLLMGQY------SHKLDEHA-- 404

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl++++++a r++ Li+dlL +sri ++
CP001769_2 405 ----------ADYLRRMQSAASRMSTLIRDLLAYSRISTQ 434

CP001769_5118: domain 1 of 1, from 176 to 242: score 40.4, E = 6.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++fl++ sH+LR L+ +g+a+ L++ ++ls e+r
CP001769_5 176 QRGDFLRTSSHDLRSGLSLSMGAAHFLQM---------DDLSLEDR- 212

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y + + r + ++L+ l+dl+r+eag
CP001769_5 213 ----------QQYADMLTRNLTNVQSLLTGLMDLARLEAG 242

CP001769_2050: domain 1 of 1, from 39 to 111: score 39.5, E = 1.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++f+ ++sHE+ TPL+aI+ a+l++ ++ ++++++ +
CP001769_2 39 YVGQFIETASHEFCTPLAAIQSSADLIEQHVN-----REAATSST-- 78

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
p +r+ l +i + l+rL++d L+ls+ieag
CP001769_2 79 -------PAIRRHLAVISAKLTALDRLLRDTLTLSQIEAG 111

CP001769_2148: domain 1 of 1, from 445 to 512: score 38.3, E = 2.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + +lL+ ++ ++++ ++
CP001769_2 445 NLQQFAYVASHDLQEPLRKIQQFGDLLKSQY--------AQTSGEA- 482

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++++a r++ Li lL +s+i ++
CP001769_2 483 ----------LVYLERMQSAAARMSVLIKALLNFSQIANQ 512

CP001769_1018: domain 1 of 1, from 1176 to 1249: score 37.6, E = 4.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++++sHE+RTPL+aI +el + +++ g+++ + ++
CP001769_1 1176 LKSQFISTASHEFRTPLAAINSSVELVKHYVN---VGSADTPMTKV- 1218

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ + +e+i + + l++Li d L++s+i++g
CP001769_1 1219 ---------INQHIEKICQKVFFLNDLITDTLTISKIDEG 1249

CP001769_1632: domain 1 of 1, from 818 to 890: score 37.1, E = 5.8e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+f++ +sH++RTPLt+I+ ++l++ + ++ +e
CP001769_1 818 LKSQFISIASHQFRTPLTSIQSSIDLIQYYI-------SKNNEFP-- 855

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++y+ i +++ l++Li d L+ls++e+g
CP001769_1 856 -----FNNIIQKYTGQISQQITFLEELIMDTLTLSKLEEG 890

CP001769_1206: domain 1 of 1, from 176 to 242: score 36.5, E = 8.5e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +l++ sH+LR I +a+lL++ + ls e+r
CP001769_1 176 LRGTMLRTTSHDLRGSFGIINSAAHLLKM---------DGLSQEER- 212

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++le + r + ++++ +l lsr+eag
CP001769_1 213 ----------DQFLEMLNRNLTNVQSMLGNLTNLSRLEAG 242

CP001769_2201: domain 1 of 1, from 594 to 661: score 35.2, E = 1.9e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL ++ + +lL +++ + + e +
CP001769_2 594 NLERFAYIASHDLQEPLRKVQQFGDLLSAQY-------GSQLGEGI- 632

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
yle+++ +a r++ Li+dlL +sri +
CP001769_2 633 -----------MYLERMQAAATRMSTLIRDLLSFSRISTW 661

CP001769_1155: domain 1 of 1, from 934 to 1002: score 34.4, E = 3.4e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+++ +l++ ++ + + e
CP001769_1 934 NLEQFAYVASHDLQEPLRKIQAFGDLIQSQFA------PVIGIEG-- 972

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++++++++a r++ Li d+L +sri +
CP001769_1 973 ----------ADMINRMQSAAARMQILIKDVLAYSRIVTK 1002

CP001769_4503: domain 1 of 1, from 793 to 852: score 34.1, E = 4.1e-09
*->sHELRTPLtaIrgyaelLleeldkvlagdtelseeqrlpeLRledpe
sH+L PL I+ +a++L +++ + +++
CP001769_4 793 SHDLQEPLRKIISFADILSTQYA------GQFDAPA----------- 822

yreyletilreaerllrLindlLdlsrieag<-*
+++++i +a+r++ Li+dlL +s+ ++
CP001769_4 823 -TDIVKRINTSANRMRLLIQDLLAYSQVDTR 852

CP001769_0099: domain 1 of 1, from 812 to 880: score 32.4, E = 1.2e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+ +sH+L PL I+ + ++L +++ +l+ ++
CP001769_0 812 NLQKFAYVASHDLQEPLRKIQSFGDVLTS----IYGHVLDLTGLDM- 853

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++++ +a+r+++Li+ lL++sr+ ++
CP001769_0 854 -------------INRMQGSAQRMSELIRHLLTYSRLSTQ 880

CP001769_3232: domain 1 of 1, from 1521 to 1605: score 31.7, E = 2e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldk....v.lagdtels
+++e++a+++HE+ +PL+ + +ae+ e +d + + + +t++
CP001769_3 1521 SLGELTAGIAHEIQNPLNFVNNFAEISSEIVDDlvleHsKPTRTAKL 1567

eeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e ++l+ L ++ l +i++ ++r ++++ +L+ sri++g
CP001769_3 1568 ESDLLTFL-------KDNLTKIHHHGQRVSNIVKGMLEHSRIGSG 1605

CP001769_2661: domain 1 of 1, from 240 to 308: score 31.2, E = 2.6e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+ +sH+L PL I+ ++ l+ e++ +++
CP001769_2 240 ELERFAFVASHDLQEPLRKIQSFSNLITERYA------NLFDADS-- 278

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++i ++aer+++Li dlL +sri +
CP001769_2 279 ----------MLFMSKISNSAERMSKLIKDLLNFSRISSH 308

CP001769_4927: domain 1 of 1, from 210 to 294: score 28.7, E = 1.4e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldk....v.lagdtels
+++e++a+++HE+ +PL+ + ++e+ e d ++++ + +++
CP001769_4 210 SLGELTAGIAHEIQNPLNFVNNFSEVSIELIDElteeQaKPDRDPEL 256

eeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e ++l+ L ++ l++i + + r ++++ +L+ sr++ag
CP001769_4 257 EAELLTDL-------KQNLQKINHHGGRASSIVKGMLQHSRAGAG 294

CP001769_2957: domain 1 of 1, from 1046 to 1123: score 28.2, E = 2e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvla....gdtelse
a +e++ ++HE+++PLt ++++++ L++ +++++++++++++
CP001769_2 1046 AWREMAKQVAHEIKNPLTPMKLTLQHLQR-----TLpggnESGNAND 1087

eqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ r+ +L ++++++l++++ l+++ + +++++ +
CP001769_2 1088 PGRRIML--------RAFDSLLDQIDNLSDIATSFSEFAKMPLP 1123

CP001769_1013: domain 1 of 1, from 289 to 356: score 27.3, E = 3.5e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++f+ +sH+L+ PL I+++ ++ + ++ ++e
CP001769_1 289 ELQQFTWVVSHDLKEPLRKIQLLNDTVKVKY-------LSTNPEA-- 326

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ yl++ ++++ r+++Li dlL +s++
CP001769_1 327 ----------AAYLDRSIQSSARMSNLIKDLLVYSQLSVH 356


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 6 0|=
-14 26 0|==
-13 97 4|*====
-12 288 149|=======*======
-11 669 773|================================ *
-10 1136 1434|======================================================= *
-9 1214 1481|==========================================================*
-8 1135 1109|====================================================*==
-7 769 699|=================================*===
-6 494 402|===================*====
-5 256 220|==========*==
-4 140 118|=====*=
-3 89 62|==*==
-2 47 32|=*=
-1 29 17|*=
0 9 8|*
1 5 4|*
2 8 2|*
3 1 1|*
4 1 0|=
5 0 0|
6 0 0|
7 1 0|=
8 1 0|=
9 0 0|
10 0 0|
11 1 0|=
12 1 0|=
13 0 0|
14 0 0|
15 2 0|=
16 0 0|
17 1 0|=
18 0 0|
> 19 98 -|=====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 317.9772
P(chi-square) = 0

Total sequences searched: 6524

Whole sequence top hits:
tophits_s report:
Total hits: 94
Satisfying E cutoff: 94
Total memory: 23K

Domain top hits:
tophits_s report:
Total hits: 94
Satisfying E cutoff: 94
Total memory: 59K


Acknowledgements:

This research is funded by:

Developed by: