Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

9 accessions found for Spirosoma linguale DSM 74  

Data for CP001769  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001769.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001769_3362 CDS_4157736-4155655 138.5 5.2e-39 1
CP001769_2202 CDS_2729248-2731194 130.3 1.1e-36 1
CP001769_3827 CDS_4687474-4690755 124.5 4.9e-35 1
CP001769_4234 CDS_5244124-5246472 119.6 1.2e-33 1
CP001769_3602 CDS_4428793-4431291 105.6 1.2e-29 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001769_3362 1/1 491 579 .. 1 94 [] 138.5 5.2e-39
CP001769_2202 1/1 448 534 .. 1 94 [] 130.3 1.1e-36
CP001769_3827 1/1 899 984 .. 1 94 [] 124.5 4.9e-35
CP001769_4234 1/1 574 655 .. 1 94 [] 119.6 1.2e-33
CP001769_3602 1/1 626 707 .. 1 94 [] 105.6 1.2e-29

Alignments of top-scoring domains:
CP001769_3362: domain 1 of 1, from 491 to 579: score 138.5, E = 5.2e-39
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNL+++SSLL LQa +de++ + aLr q+RV++
CP001769_3 491 ELHHRVKNNLAIVSSLLTLQANGLTDEKA-----IQALRKGQQRVQA 532

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY+s+ + v++++Yl+ L+e+L+q+yg +s++ +L +D+
CP001769_3 533 MSLIHQRLYQSDRVTIVNIRDYLTDLAESLMQAYGYESSNFDLQVDV 579

CP001769_2202: domain 1 of 1, from 448 to 534: score 130.3, E = 1.1e-36
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNNL+++SSLL LQ+ + +de++ a rE q+RV +
CP001769_2 448 ELHHRVKNNLAIVSSLLKLQSNRLSDEKA-----VQAVREGQQRVEA 489

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+liH++LY++e + tvd++eYl+ L ++L+++yg+++d +L l
CP001769_2 490 MSLIHQRLYQTEQVTTVDMREYLTDLSASLMRAYGHEADQFDLQ--L 534

CP001769_3827: domain 1 of 1, from 899 to 984: score 124.5, E = 4.9e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNL v+SSLL LQ+ k++d++v +ea + sqnRV+S
CP001769_3 899 EIHHRVKNNLEVVSSLLALQSAKVTDPNV-----QEAIQASQNRVQS 940

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m +iH++LY+++ l+ +++++Y+ +L e++++s+ v s + ++ +
CP001769_3 941 MGIIHQKLYQGKQLGAIEMRDYFLNLSESILDSFDVASR-VTIN--C 984

CP001769_4234: domain 1 of 1, from 574 to 655: score 119.6, E = 1.2e-33
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQvISSLL+ Q++ d + l+a rEsqnRV +
CP001769_4 574 EIHHRVKNNLQVISSLLNAQSDFLHDSTA-----LAAIRESQNRVHA 615

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH++LY+s ++ +vd+++Y++ ++++L++s+ ++ + +
CP001769_4 616 MALIHQKLYQSNNMAQVDMADYIRDIVDYLIDSFDRQHS-------I 655

CP001769_3602: domain 1 of 1, from 626 to 707: score 105.6, E = 1.2e-29
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+HHRVKNNLQ+++SLL Q+ + +de + + a ++s +R ++
CP001769_3 626 EVHHRVKNNLQMVTSLLYSQSVYLQDETA-----KLAVKDSLRRMQA 667

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAliH++LY+ e+++t+ + eY+ +L+++L +s+ +++ +
CP001769_3 668 MALIHQKLYQDENTSTIAMPEYIYELISYLQESFDERGQ-------I 707


Histogram of all scores:
score obs exp (one = represents 26 sequences)
----- --- ---
-15 12 0|=
-14 36 0|==
-13 101 40|=*==
-12 346 428|============== *
-11 1515 1193|=============================================*=============
-10 1443 1544|======================================================== *
-9 1145 1304|============================================= *
-8 816 874|================================ *
-7 413 519|================ *
-6 351 289|===========*==
-5 139 155|=====*
-4 97 82|===*
-3 53 43|=*=
-2 19 22|*
-1 13 11|*
0 9 6|*
1 7 3|*
2 1 1|*
3 1 0|=
4 1 0|=
> 5 6 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 264.8340
P(chi-square) = 0

Total sequences searched: 6524

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: