Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Stackebrandtia nassauensis DSM 44728  

Data for CP001778  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001778.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001778_2008 CDS_2159012-2160157 97.9 2.3e-28 1
CP001778_4400 CDS_4774774-4775976 95.7 1e-27 1
CP001778_1714 CDS_1825784-1826962 92.4 9.7e-27 1
CP001778_3745 CDS_4069762-4068554 90.5 3.4e-26 1
CP001778_1875 CDS_2018339-2019712 89.1 8.6e-26 1
CP001778_2035 CDS_2181425-2182627 87.1 3.5e-25 1
CP001778_2513 CDS_2696094-2697344 83.0 5.6e-24 1
CP001778_2427 CDS_2612910-2614139 82.5 8.1e-24 1
CP001778_4863 CDS_5254307-5255362 81.6 1.4e-23 1
CP001778_3575 CDS_3873120-3871978 81.3 1.7e-23 1
CP001778_5459 CDS_5900455-5899325 80.8 2.5e-23 1
CP001778_4581 CDS_4969676-4970818 80.5 3.2e-23 1
CP001778_3302 CDS_3560833-3559679 80.2 3.7e-23 1
CP001778_4494 CDS_4879364-4878174 78.5 1.2e-22 1
CP001778_4982 CDS_5384675-5383464 77.8 1.9e-22 1
CP001778_3680 CDS_3994032-3992911 77.0 3.2e-22 1
CP001778_2537 CDS_2721301-2720033 75.4 9.6e-22 1
CP001778_3649 CDS_3959528-3958404 74.4 1.9e-21 1
CP001778_2218 CDS_2388040-2386880 74.1 2.3e-21 1
CP001778_5175 CDS_5591109-5592239 73.9 2.6e-21 1
CP001778_0599 CDS_643757-642702 73.3 4e-21 1
CP001778_5550 CDS_5999180-6000616 72.2 8.5e-21 1
CP001778_4497 CDS_4883256-4882072 71.4 1.5e-20 1
CP001778_1857 CDS_1977421-1976270 70.4 3e-20 1
CP001778_0614 CDS_660580-659369 70.3 3.1e-20 1
CP001778_1934 CDS_2081175-2079913 66.9 3.1e-19 1
CP001778_2987 CDS_3205134-3206264 66.9 3.2e-19 1
CP001778_0531 CDS_571277-572638 66.1 5.5e-19 1
CP001778_5554 CDS_6004633-6003332 66.0 5.6e-19 1
CP001778_0636 CDS_680681-679539 65.7 7.3e-19 1
CP001778_3233 CDS_3478098-3476971 65.0 1.2e-18 1
CP001778_5694 CDS_6150462-6151709 64.8 1.3e-18 1
CP001778_0496 CDS_529438-528215 64.8 1.3e-18 1
CP001778_4788 CDS_5170585-5172285 62.4 6.7e-18 1
CP001778_4753 CDS_5132673-5133917 61.7 1.1e-17 1
CP001778_3266 CDS_3515272-3514157 61.5 1.2e-17 1
CP001778_2625 CDS_2812527-2811400 60.8 2e-17 1
CP001778_2596 CDS_2778678-2777398 60.5 2.3e-17 1
CP001778_1491 CDS_1595891-1594755 58.7 8e-17 1
CP001778_3611 CDS_3909806-3908580 58.6 8.6e-17 1
CP001778_4645 CDS_5029416-5028199 58.0 1.3e-16 2
CP001778_2303 CDS_2480807-2481973 54.7 1.2e-15 1
CP001778_0174 CDS_178952-180112 54.1 1.8e-15 1
CP001778_2216 CDS_2384323-2385585 53.2 3.4e-15 1
CP001778_5501 CDS_5944941-5946239 50.1 2.8e-14 1
CP001778_3044 CDS_3267997-3269733 47.2 2.1e-13 1
CP001778_5174 CDS_5590864-5589308 43.9 1.9e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001778_2008 1/1 179 246 .. 1 70 [] 97.9 2.3e-28
CP001778_4400 1/1 188 255 .. 1 70 [] 95.7 1e-27
CP001778_1714 1/1 186 254 .. 1 70 [] 92.4 9.7e-27
CP001778_3745 1/1 182 249 .. 1 70 [] 90.5 3.4e-26
CP001778_1875 1/1 248 315 .. 1 70 [] 89.1 8.6e-26
CP001778_2035 1/1 199 266 .. 1 70 [] 87.1 3.5e-25
CP001778_2513 1/1 210 277 .. 1 70 [] 83.0 5.6e-24
CP001778_2427 1/1 209 276 .. 1 70 [] 82.5 8.1e-24
CP001778_4863 1/1 155 222 .. 1 70 [] 81.6 1.4e-23
CP001778_3575 1/1 180 248 .. 1 70 [] 81.3 1.7e-23
CP001778_5459 1/1 169 236 .. 1 70 [] 80.8 2.5e-23
CP001778_4581 1/1 180 248 .. 1 70 [] 80.5 3.2e-23
CP001778_3302 1/1 184 250 .. 1 70 [] 80.2 3.7e-23
CP001778_4494 1/1 209 279 .. 1 70 [] 78.5 1.2e-22
CP001778_4982 1/1 194 266 .. 1 70 [] 77.8 1.9e-22
CP001778_3680 1/1 178 245 .. 1 70 [] 77.0 3.2e-22
CP001778_2537 1/1 225 288 .. 1 70 [] 75.4 9.6e-22
CP001778_3649 1/1 168 236 .. 1 70 [] 74.4 1.9e-21
CP001778_2218 1/1 182 247 .. 1 70 [] 74.1 2.3e-21
CP001778_5175 1/1 182 250 .. 1 70 [] 73.9 2.6e-21
CP001778_0599 1/1 152 219 .. 1 70 [] 73.3 4e-21
CP001778_5550 1/1 260 328 .. 1 70 [] 72.2 8.5e-21
CP001778_4497 1/1 184 251 .. 1 70 [] 71.4 1.5e-20
CP001778_1857 1/1 181 246 .. 1 70 [] 70.4 3e-20
CP001778_0614 1/1 207 273 .. 2 70 .] 70.3 3.1e-20
CP001778_1934 1/1 210 276 .. 1 70 [] 66.9 3.1e-19
CP001778_2987 1/1 175 243 .. 1 70 [] 66.9 3.2e-19
CP001778_0531 1/1 228 321 .. 1 70 [] 66.1 5.5e-19
CP001778_5554 1/1 233 300 .. 1 70 [] 66.0 5.6e-19
CP001778_0636 1/1 183 250 .. 1 70 [] 65.7 7.3e-19
CP001778_3233 1/1 177 244 .. 1 70 [] 65.0 1.2e-18
CP001778_5694 1/1 216 283 .. 1 70 [] 64.8 1.3e-18
CP001778_0496 1/1 202 269 .. 1 70 [] 64.8 1.3e-18
CP001778_4788 1/1 357 424 .. 1 70 [] 62.4 6.7e-18
CP001778_4753 1/1 213 280 .. 1 70 [] 61.7 1.1e-17
CP001778_3266 1/1 170 235 .. 1 70 [] 61.5 1.2e-17
CP001778_2625 1/1 178 242 .. 1 70 [] 60.8 2e-17
CP001778_2596 1/1 233 303 .. 1 70 [] 60.5 2.3e-17
CP001778_1491 1/1 174 237 .. 1 62 [. 58.7 8e-17
CP001778_3611 1/1 189 256 .. 1 70 [] 58.6 8.6e-17
CP001778_4645 2/2 215 282 .. 1 70 [] 57.5 1.9e-16
CP001778_2303 1/1 202 267 .. 1 70 [] 54.7 1.2e-15
CP001778_0174 1/1 189 256 .. 1 70 [] 54.1 1.8e-15
CP001778_2216 1/1 230 297 .. 1 70 [] 53.2 3.4e-15
CP001778_5501 1/1 130 197 .. 1 70 [] 50.1 2.8e-14
CP001778_3044 1/1 385 450 .. 1 70 [] 47.2 2.1e-13
CP001778_5174 1/1 172 238 .. 1 70 [] 43.9 1.9e-12

Alignments of top-scoring domains:
CP001778_2008: domain 1 of 1, from 179 to 246: score 97.9, E = 2.3e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+ HD+vg++Ls+i++q+++a++++ dkdp++a++al++i
CP001778_2 179 ERLRIARDVHDVVGHHLSLINVQASAALHRI--DKDPGQAETALATI 223

relarealaevRrllgdLRpaal<-*
+++++++l e+R +l +LR +++
CP001778_2 224 KTTSSQTLGELRKTLDVLRQSDE 246

CP001778_4400: domain 1 of 1, from 188 to 255: score 95.7, E = 1e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v+++Ls++++++ +arr l ++dp++a+eal++i
CP001778_4 188 ERRRIARELHDVVAHHLSVMNVMATGARRTL--TSDPDRADEALATI 232

relarealaevRrllgdLRpaal<-*
+ ++r++l+e+Rrll +LR++++
CP001778_4 233 ESTGRTTLREMRRLLEVLRTDDE 255

CP001778_1714: domain 1 of 1, from 186 to 254: score 92.4, E = 9.7e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +IARELHD+v++s+s+i++++ +a +++ +k+p+ea +al+ i
CP001778_1 186 ERLHIARELHDVVAHSMSLIAVKAAVANHVA--AKHPDEAHKALTVI 230

relarealaevRrllgdLR.paal<-*
+++a++al+e+Rrllg+LR+++++
CP001778_1 231 ETTAKTALTEMRRLLGVLRsESEE 254

CP001778_3745: domain 1 of 1, from 182 to 249: score 90.5, E = 3.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RE+HD+++Q+Ls++ + l++a r+ +dp++are+++++
CP001778_3 182 ERERLSREIHDTLAQGLSSMGMLLQAAGRVW--GTDPDAAREHVERA 226

relarealaevRrllgdLRpaal<-*
+ a e l+e+Rr ++dLRp+ l
CP001778_3 227 GAVAAENLDEARRFVRDLRPPRL 249

CP001778_1875: domain 1 of 1, from 248 to 315: score 89.1, E = 8.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s++++q+e+ar + + pe+ +++l++i
CP001778_1 248 ERARIARELHDVVAHHISMVAVQAETARLTT--PGMPEAGAQRLRAI 292

relarealaevRrllgdLRpaal<-*
++ar al+e+Rrllg+LR+++
CP001778_1 293 GDTARAALTEMRRLLGVLREDTG 315

CP001778_2035: domain 1 of 1, from 199 to 266: score 87.1, E = 3.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g++Ls+i +++e++rrll ++d ++a+e++ i
CP001778_2 199 ERLRFSRDLHDLLGHTLSVIVVKAEAIRRLL--PDDTAAAAEHAGDI 243

relarealaevRrllgdLRpaal<-*
+ ++re+l evR++++++R+++l
CP001778_2 244 ENIGRESLVEVRQAVSGYRDTDL 266

CP001778_2513: domain 1 of 1, from 210 to 277: score 83.0, E = 5.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
RaRIARELHD+v++++s+i++q+ +a+++l ++ e +r++++ i
CP001778_2 210 DRARIARELHDVVAHHMSVISVQAATAEYRL--PELREDVRDEFRSI 254

relarealaevRrllgdLRpaal<-*
+ ar++l+e+Rrllg+LR +
CP001778_2 255 GGQARQSLTEMRRLLGVLRGENE 277

CP001778_2427: domain 1 of 1, from 209 to 276: score 82.5, E = 8.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIARELHDsvg++Ls++++q+ +a r++ d++pe ar+a+ i
CP001778_2 209 ARNRIARELHDSVGHALSVVTVQSAAAGRVI--DSNPEFARRAMSSI 253

relarealaevRrllgdLRpaal<-*
+e+ar+al+e+ +lg LR+++
CP001778_2 254 EETARRALEELDTVLGILREDGP 276

CP001778_4863: domain 1 of 1, from 155 to 222: score 81.6, E = 1.4e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA+ELHD++++++s+i++q+++a++l+ d+ pe+ r al +i
CP001778_4 155 ERLRIAQELHDVLAHHISLINVQSGVALHLV--DEKPEQTRVALSAI 199

relarealaevRrllgdLRpaal<-*
+++++eal+ +R +l +LR +++
CP001778_4 200 KGASKEALTALRGALDALRSTDD 222

CP001778_3575: domain 1 of 1, from 180 to 248: score 81.3, E = 1.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD+v+++ s+i++q+++ r+++ ++ pe+a+eal+ i
CP001778_3 180 ERELLARELHDTVAHHVSGIAIQAQAGRAIA--ASRPERAAEALAII 224

relarealaevRrllgdLR.paal<-*
+++a ++l+e+R+++g+LR p++
CP001778_3 225 EDAATRTLTELRAIVGVLRaPPDT 248

CP001778_5459: domain 1 of 1, from 169 to 236: score 80.8, E = 2.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++ ++i +q+++a++++ ++dp++are + +i
CP001778_5 169 ERLELARELHDFVAHHVTGIVVQAQAAQYIT--QDDPARARESFGAI 213

relarealaevRrllgdLRpaal<-*
++++ eal+ +Rrl+ ++R ++
CP001778_5 214 EKAGLEALTSMRRLVDVMRQDDS 236

CP001778_4581: domain 1 of 1, from 180 to 248: score 80.5, E = 3.2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDs+ +++s++++q+++a+++l + pe+a++ l++i
CP001778_4 180 ERVRIARELHDSLTHAISVVNVQSSVALHML--NRQPEQAEASLRNI 224

relarealaevRrllgdLR.paal<-*
r+++++a++e+R++l++LR + ++
CP001778_4 225 RAASQDAMRELRATLRALRmTEGD 248

CP001778_3302: domain 1 of 1, from 184 to 250: score 80.2, E = 3.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l+ + p++++e+l+++
CP001778_3 184 ERERIARELHDVVTHHVTAMVVQAEAARYLT---ATPDRLDETLTAV 227

relarealaevRrllgdLRpaal<-*
+++r+a++++R+ll L p+
CP001778_3 228 TDTGRRAITDLRHLLDLLNPDHG 250

CP001778_4494: domain 1 of 1, from 209 to 279: score 78.5, E = 1.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrllds.dkdpeearealde
ER+R+AR+LHD++g+sL+ i+++++larrll+s+++d +++ +++
CP001778_4 209 ERNRLARDLHDVLGHSLTTISVKAGLARRLLESgTDDRARLVAEVSD 255

irelarealaevRrllgdLRpaal<-*
++lar+a++evR++++++R++
CP001778_4 256 SERLARQAMTEVRAVVSEYRTSLR 279

CP001778_4982: domain 1 of 1, from 194 to 266: score 77.8, E = 1.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER+RIARE+HD+++++Ls+++++++++++++ d+dp++ +++e+ +
CP001778_4 194 ERRRIAREMHDTLAHRLSLLSVHAGALAYRT--DTDPQnltptEVNA 238

aldeirelarealaevRrllgdLRpaal<-*
a + i++ a++al+e+ ++l+ LR +++
CP001778_4 239 ATQVIQDSAQRALSELGEVLTLLRSDDD 266

CP001778_3680: domain 1 of 1, from 178 to 245: score 77.0, E = 3.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD v+Q L++++l ++ ar+l+ ++d+++a +l+ +
CP001778_3 178 ERTRLARELHDAVSQKLFSLRLAASSARALA--ASDADAALSQLEKV 222

relarealaevRrllgdLRpaal<-*
+ la ea +e+R+++ +LRpa+l
CP001778_3 223 ESLAAEAARELREVIVELRPADL 245

CP001778_2537: domain 1 of 1, from 225 to 288: score 75.4, E = 9.6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+AR++HD+v+Q+L++i qle+a ++dp+ +++l+ +
CP001778_2 225 ERARLARDMHDTVAQGLAGIVTQLETA------EADPDDTARRLRIA 265

relarealaevRrllgdLRpaal<-*
r+lar++l evRr + +LRpa l
CP001778_2 266 RDLARDSLVEVRRSVAALRPALL 288

CP001778_3649: domain 1 of 1, from 168 to 236: score 74.4, E = 1.9e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IA E+HD+++++Ls+++l++++++r++ ++ pe++++++d +
CP001778_3 168 ERAQIAAEMHDVLAHRLSVLALHTGALQRRA--ATLPEQVATRIDLL 212

relarealaevRrllgdLR.paal<-*
r+++ +al+++R++lg+LR+p+ +
CP001778_3 213 RATSTDALDDLRDMLGALRnPTRD 236

CP001778_2218: domain 1 of 1, from 182 to 247: score 74.1, E = 2.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR+LHD v+++ a+ l +++a++ + +p++++eal i
CP001778_2 182 ERARIARDLHDIVAHHVGAMVLRAGAAQY----AGAPPPVAEALGDI 224

relarealaevRrllgdLRpaal<-*
r ++ + l+++R ll +LR++a
CP001778_2 225 RSTGTQVLEDLRGLLAVLRDPAA 247

CP001778_5175: domain 1 of 1, from 182 to 250: score 73.9, E = 2.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++g+s++ai++q+ +a++ll ++ +e+ +++ +i
CP001778_5 182 ERLRIARELHDVLGHSMTAIAVQSAAALHLL--GDAKPEVWQTVGAI 226

relarealaevRrllgdLR.paal<-*
r+++ a++ v ++ +L+ p ++
CP001778_5 227 RDTSVSAMSLVKSTIDTLQaPVGH 250

CP001778_0599: domain 1 of 1, from 152 to 219: score 73.3, E = 4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v++++sai l++++ar ++ ++ pe+ +eal+ei
CP001778_0 152 ERLELARELHDVVAHHISAIVLGTQAARLVV--RRQPERGDEALAEI 196

relarealaevRrllgdLRpaal<-*
++++++ala +R+++g LR++ +
CP001778_0 197 EAAGSDALASMRQVVGLLRDDRD 219

CP001778_5550: domain 1 of 1, from 260 to 328: score 72.2, E = 8.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v ++ s++ +q+++ar+++ d+ p++a++al ++
CP001778_5 260 ERARIARELHDVVTHNVSVMVIQTGAARKVM--DASPDQAKAALLAV 304

relarealaevRrllgdLR.paal<-*
++ +r a++e+R++ g L ++a
CP001778_5 305 EAGGRAAMSELRHVMGLLTmDDAA 328

CP001778_4497: domain 1 of 1, from 184 to 251: score 71.4, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE HD v+++L+++ +++a+ + d+ p+ea + +
CP001778_4 184 ERERLAREVHDIVAHNLAVMVALADGAALTV--DASPAEAGDMMGKS 228

relarealaevRrllgdLRpaal<-*
++++real e+Rrl+++LR+++
CP001778_4 229 AATGREALGELRRLVRVLRDGDG 251

CP001778_1857: domain 1 of 1, from 181 to 246: score 70.4, E = 3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA E+HD+v+++ s++ +++++++ + +++ +++e ++ i
CP001778_1 181 ERGRIAHEMHDVVAHRVSLMVMHAGALEVNA--PDA--AVAESAELI 223

relarealaevRrllgdLRpaal<-*
r++++eala++R++lg+LR ++
CP001778_1 224 RATGSEALAQLRDVLGVLRYGET 246

CP001778_0614: domain 1 of 1, from 207 to 273: score 70.3, E = 3.1e-20
*->RaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeir
R+R+A+ELHDs+g++L+ ++q+ +a +l+ ++dp+ ar+a+++i+
CP001778_0 207 RNRLAQELHDSIGHTLTTSTIQAAVANQLM--ESDPASARQAMTTIE 251

elarealaevRrllgdLRpaal<-*
e +r+al+++ ++lg+LR a
CP001778_0 252 ESSRQALDDLDHVLGVLRQEAA 273

CP001778_1934: domain 1 of 1, from 210 to 276: score 66.9, E = 3.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A ++HD+v+++ s++ lq++++r+ ++d+e r ++e+
CP001778_1 210 ERLRLASDMHDVVSHRVSLMVLQAGALRM----TTDDETTRGVAEEL 252

relarealaevRrllgdLR.paal<-*
r ++++al+e+R+++g+LR+++ +
CP001778_1 253 RSAGSQALEELRDVIGVLRsEPPD 276

CP001778_2987: domain 1 of 1, from 175 to 243: score 66.9, E = 3.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD +++sLsa ++le+ar l+ + +ea ++++++
CP001778_2 175 ERARIAREIHDILAHSLSAQLVHLEGARLLAN-AGRTDEAVDRIERA 220

relarealaevRrllgdLRpaal<-*
relar +l+e+Rr+l +LR +l
CP001778_2 221 RELARGGLTETRRALDTLRGETL 243

CP001778_0531: domain 1 of 1, from 228 to 321: score 66.1, E = 5.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER R++R+LHD+vg++L+ai+lq+++a r+l + d++ + + ++++
CP001778_0 228 ERLRLSRDLHDVVGHHLTAIALQADAATRRL--QHDAAahagasept 272

.................earealdeirelarealaevRrllgdLRpaal<
+++ ++ + + +++ ++a+ +++ ++++ar+alae+Rrl+ LR +++
CP001778_0 273 ptpadpasadavtssipPAANHFAVVADTARTALAETRRLIAYLRQGTD 321

-*

CP001778_0 - -

CP001778_5554: domain 1 of 1, from 233 to 300: score 66.0, E = 5.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l++a+ +l ++dp++a++ l+e+
CP001778_5 233 ELRRIERDLHDGAQARLVALGMSLGMAEEIL--TSDPQAAAKLLAEA 277

relarealaevRrllgdLRpaal<-*
re + al+e+R+l+++++p++l
CP001778_5 278 RENSGAALSEIRDLVRGIHPPVL 300

CP001778_0636: domain 1 of 1, from 183 to 250: score 65.7, E = 7.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDs+ +++s+ik+q+++a +l+ +k ++ eal++i
CP001778_0 183 ERLRIARELHDSLTHAISVIKMQSSVAVHLA--AKQGQRPSEALTAI 227

relarealaevRrllgdLRpaal<-*
++++ ea +e+R +l +LR+++
CP001778_0 228 QQASIEANRELRSTLKVLRDDQP 250

CP001778_3233: domain 1 of 1, from 177 to 244: score 65.0, E = 1.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +IARELHDs+ +++s++k+q+e+a +++ +k e++ +a+ +i
CP001778_3 177 ERLHIARELHDSLTHQISVVKVQSEVAVHVA--RKRGEQVPDAVLAI 221

relarealaevRrllgdLRpaal<-*
++++rea +e+R++l +LR+++
CP001778_3 222 QKAGREATRELRATLAALRDDDT 244

CP001778_5694: domain 1 of 1, from 216 to 283: score 64.8, E = 1.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR++RE+HDsvg+ L++i+l+l a+r ++ + a ++++++
CP001778_5 216 ERARMSREMHDSVGHYLTVISLGLRNAQRYR--EAGVGDAWAEVAQA 260

relarealaevRrllgdLRpaal<-*
r+l eal+e+Rr + +LRp al
CP001778_5 261 RQLTTEALEETRRWVKALRPLAL 283

CP001778_0496: domain 1 of 1, from 202 to 269: score 64.8, E = 1.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L +i+l++ela+rl +dp++a + ++e+
CP001778_0 202 ERLRFAADLHDIQGHHLQVIALKSELAARLG--GRDPDKAVALMREV 246

relarealaevRrllgdLRpaal<-*
++lar+al+++R+++ ++R
CP001778_0 247 QDLARDALSDTRAVVAGYRSVSP 269

CP001778_4788: domain 1 of 1, from 357 to 424: score 62.4, E = 6.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q L+++ +++ a+++l ++d+ +e+l+e+
CP001778_4 357 ERQRLAREIHDGIAQELAMLGYGIDHALAQL--PADATDSAEQLQEL 401

relarealaevRrllgdLRpaal<-*
r+ + + ++e+R l +LR ++
CP001778_4 402 RDEVTRLITELRLSLFELRSEVD 424

CP001778_4753: domain 1 of 1, from 213 to 280: score 61.7, E = 1.1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+++ +Lsai++ +++++++ d+e r ++ i
CP001778_4 213 ERTRMARELHDTIANHLSAIAMRSSAVLAQP--NMDAETMRGIVADI 257

relarealaevRrllgdLRpaal<-*
r+ + +lae+R ++ LR ++
CP001778_4 258 RAGSVAGLAEMRGTIELLRRGES 280

CP001778_3266: domain 1 of 1, from 170 to 235: score 61.5, E = 1.2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++ + + + + ++ e +ea+++i
CP001778_3 170 ERAQLAREMHDVVSHQVSLIAVRAAAWQVST--GDP--ESKEAAATI 212

relarealaevRrllgdLRpaal<-*
r+l+ ++l+e+R+++++LR a+
CP001778_3 213 RQLSTRTLDELRHMVSVLRAAGS 235

CP001778_2625: domain 1 of 1, from 178 to 242: score 60.8, E = 2e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa++ARE+HD+v+++ s+i++ +++++ ++ e++++++d+i
CP001778_2 178 ERAHLAREMHDVVSHQVSLIAVRAGALQ-----VSAQEPVAREADTI 219

relarealaevRrllgdLRpaal<-*
r+la ++l+e+R ++++LR ++
CP001778_2 220 RTLATRTLDELRYMVSVLRAGGG 242

CP001778_2596: domain 1 of 1, from 233 to 303: score 60.5, E = 2.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpeeareald
E +RI R+LHD+v +L a++++l++++r+l s++++ p+ a ++
CP001778_2 233 ELRRIERDLHDGVQNRLVAVTMHLGMVERAL-SrePSRPATALPLVR 278

eirelarealaevRrllgdLRpaal<-*
e++e+a ealae+R+++++ p++l
CP001778_2 279 EVQETAVEALAELRQVVRAVYPPIL 303

CP001778_1491: domain 1 of 1, from 174 to 237: score 58.7, E = 8e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ER +IARE HD+vg+sL+ai+l++++a+++l+ ++ + + e+ e l
CP001778_1 174 ERLHIAREVHDVVGHSLTAIRLHAGVALHVLH-RDGVAvpaEVTESL 219

deirelarealaevRrll<-*
++ir+ ++ al+e+R++l
CP001778_1 220 TAIRDSGSAALDELRATL 237

CP001778_3611: domain 1 of 1, from 189 to 256: score 58.6, E = 8.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARELHD v++++++i l +++ar +l ++ ++ +e+ld +
CP001778_3 189 ERVTIARELHDLVAHQIASILLRVGVAREVL--PDLGQATKETLDDV 233

relarealaevRrllgdLRpaal<-*
++ a + l+++Rrl++ LR ++
CP001778_3 234 HDCAATVLDDLRRLVRMLRSGEG 256

CP001778_4645: domain 2 of 2, from 215 to 282: score 57.5, E = 1.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD++ +L ai ++l++ +r+ + pe a++ +d++
CP001778_4 215 ELRRIERDLHDGIQARLVAIGIHLGVSQRQR--GDTPESADQLVDRA 259

relarealaevRrllgdLRpaal<-*
r+ ++e+l+e+ ++++++ p++l
CP001778_4 260 RTGVEETLTELQAVVRGIYPPIL 282

CP001778_2303: domain 1 of 1, from 202 to 267: score 54.7, E = 1.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R++HD+v Q+ a+ + +++arr +dp + +e l+++
CP001778_2 202 ERRRIERDIHDGVQQRTVALGMLIGRARR----GEDPRRREELLAQA 244

relarealaevRrllgdLRpaal<-*
+ ++ l+++R++ +++ p+al
CP001778_2 245 HLESQALLSDLREVSWRIYPTAL 267

CP001778_0174: domain 1 of 1, from 189 to 256: score 54.1, E = 1.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIARE+HD+v +++s+++l+++++ ++ d +p + +r ++
CP001778_0 189 ERTRIAREMHDVVTHRISLVALHAGGL--MV--DPEPKidVVRGSAE 231

eirelarealaevRrllgdLRpaal<-*
i + ar+al+e+R +lg+LR ++
CP001778_0 232 LIYGSARQALEELRLALGALRADEP 256

CP001778_2216: domain 1 of 1, from 230 to 297: score 53.2, E = 3.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R LHD+ +L ++++ +++ar++l ++dp+ a++ l+++
CP001778_2 230 ELRRIERALHDGAQNRLVGVAVLVGAARQAL--RRDPDHADAVLERA 274

relarealaevRrllgdLRpaal<-*
+ +a++alae+R +++ + p++l
CP001778_2 275 QSTAEDALAELRSVVRSILPPVL 297

CP001778_5501: domain 1 of 1, from 130 to 197: score 50.1, E = 2.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA ++HDs+g+sL++i+l ++ ++ l+ + +e r a++++
CP001778_5 130 ERARIAADMHDSLGHSLALIALRAGSLE-LA--QGLSDEHRLAAERL 173

relarealaevRrllgdLR.paal<-*
r+ a a +e+R+++ LR+p++
CP001778_5 174 RADAVSATDELRHTIALLRsPGQA 197

CP001778_3044: domain 1 of 1, from 385 to 450: score 47.2, E = 2.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
R+RIA +LHD v Q+L + + l++ + ++ +e+ ar+++++
CP001778_3 385 DRERIAADLHDHVIQRLYGCGMNLQATL-----PRVNEpGARRRIQT 426

irelarealaevRrllgdLRpaal<-*
+ e ++++++e+R + +L+ + +
CP001778_3 427 VVEELDTTIREIRTSIFALQSTSE 450

CP001778_5174: domain 1 of 1, from 172 to 238: score 43.9, E = 1.9e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ++HDs+g+ Ls+i+l + +++ d ++ p++ +ea+ ++
CP001778_5 172 ERTRIAEDMHDSLGHELSLIALRAAALEV--D-RELPQRHQEAAGQL 215

relarealaevRrllgdLRpaal<-*
r+ a +a + +R+++g LR+ +
CP001778_5 216 RRSAATATERLREIIGLLRDESE 238


Histogram of all scores:
score obs exp (one = represents 18 sequences)
----- --- ---
-15 1 0|=
-14 11 0|=
-13 74 0|=====
-12 124 71|===*===
-11 216 584|============ *
-10 706 1356|======================================== *
-9 1023 1540|========================================================= *
-8 973 1187|======================================================= *
-7 905 746|=========================================*=========
-6 750 422|=======================*==================
-5 642 226|============*=======================
-4 315 118|======*===========
-3 225 60|===*=========
-2 144 31|=*======
-1 92 15|*=====
0 60 8|*===
1 23 4|*=
2 23 2|*=
3 11 1|*
4 3 0|=
5 4 0|=
6 3 0|=
> 7 51 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3727.7712
P(chi-square) = 0

Total sequences searched: 6379

Whole sequence top hits:
tophits_s report:
Total hits: 47
Satisfying E cutoff: 47
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 47
Satisfying E cutoff: 47
Total memory: 37K


Acknowledgements:

This research is funded by:

Developed by: