Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Gordonia bronchialis DSM 43247  

Data for CP001802  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001802.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001802_0267 CDS_319949-318618 91.1 1.6e-26 1
CP001802_2588 CDS_2909476-2908373 85.0 1.1e-24 1
CP001802_3083 CDS_3471169-3469901 82.4 6.2e-24 1
CP001802_3919 CDS_4421489-4420359 73.1 3.4e-21 1
CP001802_2733 CDS_3082917-3081676 72.2 6.1e-21 1
CP001802_2025 CDS_2269619-2271268 62.9 3.4e-18 1
CP001802_3306 CDS_3689125-3690282 62.0 6.3e-18 1
CP001802_1828 CDS_2034968-2036425 54.7 8.7e-16 1
CP001802_0171 CDS_198149-196680 53.8 1.7e-15 1
CP001802_4299 CDS_4853833-4855008 31.6 5.7e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001802_0267 1/1 224 291 .. 1 70 [] 91.1 1.6e-26
CP001802_2588 1/1 163 230 .. 1 70 [] 85.0 1.1e-24
CP001802_3083 1/1 205 272 .. 1 70 [] 82.4 6.2e-24
CP001802_3919 1/1 174 241 .. 1 70 [] 73.1 3.4e-21
CP001802_2733 1/1 195 262 .. 1 70 [] 72.2 6.1e-21
CP001802_2025 1/1 342 413 .. 1 70 [] 62.9 3.4e-18
CP001802_3306 1/1 181 250 .. 1 70 [] 62.0 6.3e-18
CP001802_1828 1/1 260 324 .. 1 70 [] 54.7 8.7e-16
CP001802_0171 1/1 192 258 .. 1 70 [] 53.8 1.7e-15
CP001802_4299 1/1 197 258 .. 9 70 .] 31.6 5.7e-09

Alignments of top-scoring domains:
CP001802_0267: domain 1 of 1, from 224 to 291: score 91.1, E = 1.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s+i +q+++arr+l ++dpe+a++ l +i
CP001802_0 224 ERLRIARELHDVVAHHVSVIGVQAGAARRVL--ARDPEQAATSLSAI 268

relarealaevRrllgdLRpaal<-*
+e area ae+ llg+LR+++
CP001802_0 269 EESAREAVAELHGLLGTLRHGTG 291

CP001802_2588: domain 1 of 1, from 163 to 230: score 85.0, E = 1.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD++++++s++++ ++++++++ d +e+r+++++i
CP001802_2 163 ERARIAREMHDVLAHRISVVSMTAGALAYRT--DLSTDEVRATAKTI 207

relarealaevRrllgdLRpaal<-*
+e+++ al+e+R++lg+LR++
CP001802_2 208 QETSHLALTELREVLGVLREGPG 230

CP001802_3083: domain 1 of 1, from 205 to 272: score 82.4, E = 6.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD v++++s++ +++++ar+++ d +++++e++d+i
CP001802_3 205 ERTRIARDLHDIVAHRMSVVVVMAQTARYRI--DGVDGAVAEEFDAI 249

relarealaevRrllgdLRpaal<-*
+++ar al+evR++lg+LR +a+
CP001802_3 250 ADAARSALDEVRQMLGVLRLDAE 272

CP001802_3919: domain 1 of 1, from 174 to 241: score 73.1, E = 3.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IAR+LHDsv+++L +++q+++a++ll d+ pe+ar+a+ +i
CP001802_3 174 ERLEIARDLHDSVAHALVTVTVQADVAAKLL--DRRPEQARAAIGAI 218

relarealaevRrllgdLRpaal<-*
r+++ +al+e+ +l++LR+ +
CP001802_3 219 RQAGADALDELGSILTALRDEQG 241

CP001802_2733: domain 1 of 1, from 195 to 262: score 72.2, E = 6.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++RE+HD+v+QsLs+i + l +a+r + +++++ ++l +
CP001802_2 195 ERERLSREIHDTVAQSLSSIQMLLFAAERSV--VHADAPVPAELPVA 239

relarealaevRrllgdLRpaal<-*
re+a eal+e+Rrl+ +L pa l
CP001802_2 240 REAAAEALTETRRLIAELSPAPL 262

CP001802_2025: domain 1 of 1, from 342 to 413: score 62.9, E = 3.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrllds...dkdpeeareal
R+RIAR+LHD v Q+L+a+ + ++++++++ +++ dp+++ e+l
CP001802_2 342 DRHRIARDLHDHVIQRLFAVGMSVQTLLAHA-AagtAPDPDQVNERL 387

deirelarealaevRrllgdLRpaal<-*
++i + +++++a++R + dL++
CP001802_2 388 EQISTDLDRTIAQIRTSIFDLQTIPG 413

CP001802_3306: domain 1 of 1, from 181 to 250: score 62.0, E = 6.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD +++sLs +l + +arr+l++d+d + a +al+ +
CP001802_3 181 ERRRIAREIHDIIAHSLSITMLNVTGARRALEQDADIDDAVDALRDA 227

relarealaevRrllgdLRpaal<-*
++ +r+a++e+R++++ L ++
CP001802_3 228 ERQGRQAMSEIRNIVHLLGSDES 250

CP001802_1828: domain 1 of 1, from 260 to 324: score 54.7, E = 8.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHDsv Qs ++ +++e++r+ ++dp + +++l+ +
CP001802_1 260 ERERIARELHDSVTQSVLSAGVHIEVCRM----ESDP-RTADRLEVA 301

relarealaevRrllgdLRpaal<-*
+l r a +++R ++ +L a
CP001802_1 302 GRLTRNAVEQLRSVIYALNQAPS 324

CP001802_0171: domain 1 of 1, from 192 to 258: score 53.8, E = 1.7e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+++ +Lsai++++ +a+ +++++p ++ l+ i
CP001802_0 192 ERHRLARELHDVIAGRLSAIAMHSAAAL---EYPTNPVLTDKVLRSI 235

relarealaevRrllgdLRpaal<-*
re + +al+e+R ++ L ++a
CP001802_0 236 RESSVDALREMRGMIDLLAEDAT 258

CP001802_4299: domain 1 of 1, from 197 to 258: score 31.6, E = 5.7e-09
*->LHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeirelarea
LHD+++++Ls++++ l++a +++ + ++e+++ l+++ +lar++
CP001802_4 197 LHDVLAHTLSGLIVTLQGASLMAR-QQQVAtELDDKLRTAVALARDG 242

laevRrllgdLRpaal<-*
l e+R+++ LR+++
CP001802_4 243 LHEARDAVESLREPVI 258


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 11 0|=
-13 55 0|=====
-12 92 51|===*====
-11 129 423|========== *
-10 481 981|===================================== *
-9 756 1114|==========================================================*
-8 726 859|======================================================== *
-7 664 540|=========================================*==========
-6 531 305|=======================*=================
-5 501 163|============*==========================
-4 266 85|======*==============
-3 150 44|===*========
-2 98 22|=*======
-1 57 11|*====
0 31 5|*==
1 22 2|*=
2 19 1|*=
3 4 0|=
4 2 0|=
5 6 0|=
6 1 0|=
7 1 0|=
8 0 0|
> 9 13 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2693.8296
P(chi-square) = 0

Total sequences searched: 4616

Whole sequence top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 10
Satisfying E cutoff: 10
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: