Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
35 projects found  

1 accessions found for Haliangium ochraceum DSM 14365  

Data for CP001804  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_1.hmm [HisKA]
Sequence database: CP001804.Gprot.fsa
per-sequence score cutoff: >= 26.8 [TC1]
per-domain score cutoff: >= 26.8 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA
Accession: PF00512.12
Description: His Kinase A (phosphoacceptor) domain
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001804_3001 CDS_4317121-4321341 143.7 3.6e-40 2
CP001804_4964 CDS_7055238-7052725 124.9 7.6e-35 2
CP001804_3063 CDS_4415314-4417611 105.6 2.3e-29 1
CP001804_5400 CDS_7630079-7632736 100.1 8.4e-28 1
CP001804_1700 CDS_2480223-2483120 99.8 9.9e-28 1
CP001804_2123 CDS_3085109-3087895 99.8 1e-27 1
CP001804_3886 CDS_5529901-5532408 98.3 2.8e-27 1
CP001804_2446 CDS_3529383-3526753 96.0 1.2e-26 1
CP001804_5118 CDS_7252555-7255047 95.8 1.4e-26 1
CP001804_3640 CDS_5196347-5193951 94.1 4.1e-26 1
CP001804_6373 CDS_8986402-8983805 92.8 9.9e-26 1
CP001804_2077 CDS_3024167-3026068 91.8 1.9e-25 1
CP001804_4691 CDS_6629332-6627809 91.4 2.5e-25 1
CP001804_6040 CDS_8511577-8505920 91.2 2.7e-25 1
CP001804_3017 CDS_4342263-4344842 90.0 6.2e-25 1
CP001804_2084 CDS_3039699-3033931 89.3 9.4e-25 1
CP001804_2450 CDS_3533239-3534432 85.8 9.5e-24 1
CP001804_5123 CDS_7260426-7258327 84.0 3e-23 1
CP001804_5836 CDS_8224678-8226393 82.2 9.7e-23 1
CP001804_1838 CDS_2655832-2657784 82.1 1.1e-22 1
CP001804_6070 CDS_8554172-8552613 81.7 1.3e-22 1
CP001804_1979 CDS_2869080-2875403 78.6 1e-21 1
CP001804_4515 CDS_6383531-6381987 76.2 4.8e-21 1
CP001804_3138 CDS_4516511-4523917 74.7 1.3e-20 1
CP001804_1978 CDS_2867309-2869027 74.3 1.7e-20 1
CP001804_5853 CDS_8245634-8250634 73.7 2.6e-20 1
CP001804_0549 CDS_746582-745617 72.6 5.3e-20 1
CP001804_0266 CDS_397090-395474 71.7 9.2e-20 1
CP001804_3672 CDS_5238821-5242216 70.7 1.7e-19 1
CP001804_3110 CDS_4482238-4478192 70.2 2.5e-19 1
CP001804_4517 CDS_6386911-6385781 69.9 2.9e-19 1
CP001804_6417 CDS_9044042-9046762 67.4 1.5e-18 1
CP001804_1316 CDS_1885536-1890815 65.8 4.4e-18 1
CP001804_4425 CDS_6257713-6259749 65.6 4.8e-18 1
CP001804_5095 CDS_7219791-7214695 65.0 7.4e-18 1
CP001804_4488 CDS_6343309-6347670 63.6 1.8e-17 1
CP001804_5399 CDS_7627642-7629900 62.6 3.5e-17 1
CP001804_5493 CDS_7766103-7764295 62.5 3.8e-17 1
CP001804_5686 CDS_8031144-8032952 61.8 6e-17 1
CP001804_3083 CDS_4442614-4441292 61.3 8.2e-17 1
CP001804_5821 CDS_8208319-8209869 60.5 1.4e-16 2
CP001804_4673 CDS_6605572-6603824 60.3 1.5e-16 1
CP001804_4574 CDS_6456139-6457245 59.5 2.6e-16 1
CP001804_2982 CDS_4296079-4297701 56.0 2.6e-15 1
CP001804_2131 CDS_3100714-3102837 55.4 3.8e-15 1
CP001804_5473 CDS_7741987-7740365 53.5 1.4e-14 1
CP001804_3163 CDS_4557381-4555891 52.5 2.5e-14 1
CP001804_4708 CDS_6712253-6710190 51.8 4.1e-14 1
CP001804_3287 CDS_4731409-4737504 50.2 1.2e-13 1
CP001804_4572 CDS_6453387-6455711 49.3 2.1e-13 1
CP001804_2572 CDS_3699658-3701898 48.9 2.7e-13 1
CP001804_6374 CDS_8986661-8987854 48.3 3.9e-13 1
CP001804_3111 CDS_4483525-4482269 46.9 1e-12 1
CP001804_5362 CDS_7580308-7578734 46.6 1.2e-12 1
CP001804_3376 CDS_4849764-4847920 46.3 1.5e-12 1
CP001804_6650 CDS_9358927-9360324 46.0 1.8e-12 1
CP001804_1271 CDS_1800917-1802803 45.8 2e-12 1
CP001804_2180 CDS_3174819-3176261 43.5 9.2e-12 1
CP001804_6642 CDS_9350648-9352246 43.1 1.2e-11 1
CP001804_2866 CDS_4155673-4157172 42.6 1.6e-11 1
CP001804_2455 CDS_3539275-3541650 42.4 1.9e-11 1
CP001804_6518 CDS_9179900-9178551 42.4 1.9e-11 1
CP001804_2456 CDS_3541653-3543332 42.3 2e-11 1
CP001804_4290 CDS_6076415-6078247 42.0 2.5e-11 1
CP001804_2078 CDS_3026109-3027296 41.6 3.2e-11 1
CP001804_2163 CDS_3144871-3146091 39.8 1e-10 1
CP001804_5579 CDS_7877264-7875732 39.5 1.2e-10 1
CP001804_4926 CDS_7003466-7005499 39.1 1.6e-10 1
CP001804_5201 CDS_7373112-7374338 39.0 1.7e-10 1
CP001804_2346 CDS_3381824-3380724 38.9 1.9e-10 1
CP001804_5288 CDS_7478588-7479934 38.7 2.1e-10 2
CP001804_5748 CDS_8105019-8107379 36.6 8.2e-10 1
CP001804_1781 CDS_2582756-2584402 36.1 1.1e-09 1
CP001804_2178 CDS_3167934-3173327 34.9 2.5e-09 1
CP001804_2573 CDS_3703731-3705713 34.5 3.2e-09 1
CP001804_2284 CDS_3308268-3311027 34.4 3.5e-09 1
CP001804_5641 CDS_7978811-7975839 32.2 1.5e-08 1
CP001804_0222 CDS_326567-328510 31.9 1.8e-08 1
CP001804_1874 CDS_2719164-2720972 31.4 2.4e-08 1
CP001804_6216 CDS_8758064-8760130 30.6 4e-08 1
CP001804_4471 CDS_6326668-6321326 30.3 5.1e-08 1
CP001804_5613 CDS_7931859-7930651 28.1 2.1e-07 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001804_3063 1/1 387 452 .. 1 87 [] 105.6 2.3e-29
CP001804_5400 1/1 316 381 .. 1 87 [] 100.1 8.4e-28
CP001804_1700 1/1 470 535 .. 1 87 [] 99.8 9.9e-28
CP001804_2123 1/1 298 363 .. 1 87 [] 99.8 1e-27
CP001804_3886 1/1 275 340 .. 1 87 [] 98.3 2.8e-27
CP001804_2446 1/1 214 279 .. 1 87 [] 96.0 1.2e-26
CP001804_5118 1/1 308 373 .. 1 87 [] 95.8 1.4e-26
CP001804_3640 1/1 563 628 .. 1 87 [] 94.1 4.1e-26
CP001804_6373 1/1 412 478 .. 1 87 [] 92.8 9.9e-26
CP001804_2077 1/1 163 229 .. 1 87 [] 91.8 1.9e-25
CP001804_4691 1/1 147 212 .. 1 87 [] 91.4 2.5e-25
CP001804_6040 1/1 1493 1558 .. 1 87 [] 91.2 2.7e-25
CP001804_3017 1/1 330 395 .. 1 87 [] 90.0 6.2e-25
CP001804_2084 1/1 1496 1561 .. 1 87 [] 89.3 9.4e-25
CP001804_2450 1/1 149 217 .. 1 87 [] 85.8 9.5e-24
CP001804_5123 1/1 465 533 .. 1 87 [] 84.0 3e-23
CP001804_5836 1/1 348 415 .. 1 87 [] 82.2 9.7e-23
CP001804_1838 1/1 256 321 .. 1 87 [] 82.1 1.1e-22
CP001804_6070 1/1 154 220 .. 1 87 [] 81.7 1.3e-22
CP001804_1979 1/1 1408 1476 .. 1 87 [] 78.6 1e-21
CP001804_4515 1/1 287 354 .. 1 87 [] 76.2 4.8e-21
CP001804_3138 1/1 2100 2166 .. 1 87 [] 74.7 1.3e-20
CP001804_3001 1/2 348 416 .. 1 87 [] 74.5 1.5e-20
CP001804_1978 1/1 195 261 .. 1 87 [] 74.3 1.7e-20
CP001804_5853 1/1 1401 1469 .. 1 87 [] 73.7 2.6e-20
CP001804_0549 1/1 80 147 .. 1 87 [] 72.6 5.3e-20
CP001804_0266 1/1 324 391 .. 1 87 [] 71.7 9.2e-20
CP001804_3672 1/1 424 492 .. 1 87 [] 70.7 1.7e-19
CP001804_3110 1/1 989 1055 .. 1 87 [] 70.2 2.5e-19
CP001804_4517 1/1 137 205 .. 1 87 [] 69.9 2.9e-19
CP001804_4964 1/2 149 215 .. 1 87 [] 69.2 4.6e-19
CP001804_3001 2/2 1024 1090 .. 1 87 [] 69.2 4.7e-19
CP001804_6417 1/1 541 607 .. 1 87 [] 67.4 1.5e-18
CP001804_1316 1/1 1384 1450 .. 1 87 [] 65.8 4.4e-18
CP001804_4425 1/1 278 348 .. 1 87 [] 65.6 4.8e-18
CP001804_5095 1/1 1332 1398 .. 1 87 [] 65.0 7.4e-18
CP001804_4488 1/1 1087 1155 .. 1 87 [] 63.6 1.8e-17
CP001804_5399 1/1 484 554 .. 1 87 [] 62.6 3.5e-17
CP001804_5493 1/1 381 446 .. 1 87 [] 62.5 3.8e-17
CP001804_5686 1/1 379 445 .. 1 87 [] 61.8 6e-17
CP001804_3083 1/1 234 300 .. 1 87 [] 61.3 8.2e-17
CP001804_4673 1/1 367 433 .. 1 87 [] 60.3 1.5e-16
CP001804_4574 1/1 146 211 .. 1 87 [] 59.5 2.6e-16
CP001804_2982 1/1 178 244 .. 1 87 [] 56.0 2.6e-15
CP001804_4964 2/2 591 658 .. 1 87 [] 55.7 3.2e-15
CP001804_2131 1/1 352 418 .. 1 87 [] 55.4 3.8e-15
CP001804_5821 1/2 287 353 .. 1 87 [] 54.7 6.2e-15
CP001804_5473 1/1 322 390 .. 1 87 [] 53.5 1.4e-14
CP001804_3163 1/1 263 329 .. 1 87 [] 52.5 2.5e-14
CP001804_4708 1/1 433 500 .. 1 87 [] 51.8 4.1e-14
CP001804_3287 1/1 1657 1723 .. 1 87 [] 50.2 1.2e-13
CP001804_4572 1/1 539 607 .. 1 87 [] 49.3 2.1e-13
CP001804_2572 1/1 522 584 .. 1 79 [. 48.9 2.7e-13
CP001804_6374 1/1 180 246 .. 1 87 [] 48.3 3.9e-13
CP001804_3111 1/1 197 263 .. 1 87 [] 46.9 1e-12
CP001804_5362 1/1 308 374 .. 1 87 [] 46.6 1.2e-12
CP001804_3376 1/1 248 323 .. 1 87 [] 46.3 1.5e-12
CP001804_6650 1/1 244 310 .. 1 87 [] 46.0 1.8e-12
CP001804_1271 1/1 408 476 .. 1 87 [] 45.8 2e-12
CP001804_2180 1/1 247 313 .. 1 87 [] 43.5 9.2e-12
CP001804_6642 1/1 297 372 .. 1 87 [] 43.1 1.2e-11
CP001804_2866 1/1 269 337 .. 1 87 [] 42.6 1.6e-11
CP001804_2455 1/1 609 675 .. 1 87 [] 42.4 1.9e-11
CP001804_6518 1/1 212 287 .. 1 87 [] 42.4 1.9e-11
CP001804_2456 1/1 329 405 .. 1 87 [] 42.3 2e-11
CP001804_4290 1/1 346 417 .. 1 87 [] 42.0 2.5e-11
CP001804_2078 1/1 167 240 .. 1 87 [] 41.6 3.2e-11
CP001804_2163 1/1 174 242 .. 1 87 [] 39.8 1e-10
CP001804_5579 1/1 144 219 .. 1 87 [] 39.5 1.2e-10
CP001804_4926 1/1 424 492 .. 1 87 [] 39.1 1.6e-10
CP001804_5201 1/1 184 251 .. 1 87 [] 39.0 1.7e-10
CP001804_2346 1/1 144 211 .. 1 87 [] 38.9 1.9e-10
CP001804_5748 1/1 403 470 .. 1 87 [] 36.6 8.2e-10
CP001804_1781 1/1 294 359 .. 1 87 [] 36.1 1.1e-09
CP001804_2178 1/1 1554 1627 .. 1 87 [] 34.9 2.5e-09
CP001804_2573 1/1 284 350 .. 1 87 [] 34.5 3.2e-09
CP001804_2284 1/1 676 755 .. 1 87 [] 34.4 3.5e-09
CP001804_5641 1/1 621 698 .. 1 87 [] 32.2 1.5e-08
CP001804_0222 1/1 262 337 .. 1 87 [] 31.9 1.8e-08
CP001804_1874 1/1 246 319 .. 1 87 [] 31.4 2.4e-08
CP001804_6216 1/1 281 356 .. 1 87 [] 30.6 4e-08
CP001804_4471 1/1 1528 1617 .. 1 87 [] 30.3 5.1e-08
CP001804_5613 1/1 183 251 .. 1 87 [] 28.1 2.1e-07

Alignments of top-scoring domains:
CP001804_3063: domain 1 of 1, from 387 to 452: score 105.6, E = 2.3e-29
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+fla++sHE+RTPL++++g+a+lLl+ tels+eq
CP001804_3 387 VKSDFLATMSHEIRTPLNGVIGMASLLLD---------TELSDEQ-- 422

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
rey eti+ +++ ll+Lind+Ld+s+ieag
CP001804_3 423 ----------REYAETIDVSGNLLLALINDILDFSKIEAG 452

CP001804_5400: domain 1 of 1, from 316 to 381: score 100.1, E = 8.4e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla++sHE+RTPL++I+g++ lLl+ tel++eq
CP001804_5 316 AKSEFLASMSHEIRTPLNGIIGMSTLLLD---------TELDDEQ-- 351

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+ +ti++++ ll Lin++Ld+s+ie+g
CP001804_5 352 ----------RELAKTIDDSGAALLGLINNILDFSKIESG 381

CP001804_1700: domain 1 of 1, from 470 to 535: score 99.8, E = 9.9e-28
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+eflan+sHE RTPL++I+g+++lL++ tel++eq
CP001804_1 470 AKTEFLANISHEVRTPLSGIIGMTSLLRT---------TELDAEQ-- 505

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y+ t++ ++ ll+LindlLd+sr+eag
CP001804_1 506 ----------ADYVATVEASGSTLLNLINDLLDISRLEAG 535

CP001804_2123: domain 1 of 1, from 298 to 363: score 99.8, E = 1e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+flan+sHE+RTPL++++g+a+lLl+ t ls+eq
CP001804_2 298 VKSQFLANMSHEIRTPLNGVLGMADLLLD---------TGLSPEQ-- 333

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l+ ++++a+ l+ Li+d+Ld+s+ieag
CP001804_2 334 ----------RELLDALQSSANALRGLIEDVLDISKIEAG 363

CP001804_3886: domain 1 of 1, from 275 to 340: score 98.3, E = 2.8e-27
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aksefla++sHE+RTPL++++g++elLl + ls eq
CP001804_3 275 AKSEFLATMSHEIRTPLSGVIGMSELLLG---------GRLSGEQ-- 310

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+ et+ +ae ll+Lind+Ld+s+ e+g
CP001804_3 311 ----------REFAETLNTSAEALLSLINDILDFSKFESG 340

CP001804_2446: domain 1 of 1, from 214 to 279: score 96.0, E = 1.2e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
akseflan+sHE+RTP+++++g++ lLl+ t l +eq
CP001804_2 214 AKSEFLANMSHEIRTPMNGVLGMLGLLLD---------TRLAAEQ-- 249

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+y et++ +a ll++ind+Ldls+ eag
CP001804_2 250 ----------RDYAETARASAMTLLDIINDILDLSKVEAG 279

CP001804_5118: domain 1 of 1, from 308 to 373: score 95.8, E = 1.4e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++sHELRTP+++++g+a lLl+ l +e
CP001804_5 308 AKSRFLATMSHELRTPMNGVLGMAGLLLD---------MGLAPEP-- 343

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey+eti+++++ ll++ind+Ld+s++eag
CP001804_5 344 ----------SEYVETIRSSGDALLAIINDILDFSKLEAG 373

CP001804_3640: domain 1 of 1, from 563 to 628: score 94.1, E = 4.1e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fl n+sHE+RTPL+a++g++elL + tel++eq
CP001804_3 563 AKSRFLNNMSHEMRTPLNAVIGMTELLID---------TELDDEQ-- 598

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
rey e++ +++ ll+Li+d+Ld +rie+g
CP001804_3 599 ----------REYAEVVTEAGVALLALIDDVLDVARIESG 628

CP001804_6373: domain 1 of 1, from 412 to 478: score 92.8, E = 9.9e-26
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ flan+sHELRTPL+aI+gya++L + d++l+e+q
CP001804_6 412 AKTAFLANMSHELRTPLNAILGYAQMLGD--------DDNLTEQQ-- 448

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l t++ ++e+l L++dlLd+s+ie+
CP001804_6 449 ----------RDALTTMRTSGEHLATLLEDLLDISKIESD 478

CP001804_2077: domain 1 of 1, from 163 to 229: score 91.8, E = 1.9e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+s fl+n+sHELRTPL++I+gya+lL+ d+els+ q
CP001804_2 163 TRSSFLSNMSHELRTPLNGILGYAQLLQV--------DSELSARQ-- 199

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re +etilr++e+ll Lind+Ldl++ eag
CP001804_2 200 ----------REGVETILRSGEHLLVLINDMLDLAKVEAG 229

CP001804_4691: domain 1 of 1, from 147 to 212: score 91.4, E = 2.5e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++fla +sHE+RTPL++++g ++lL++ tels+eq
CP001804_4 147 ARTQFLAVMSHEIRTPLHGMLGITHLLKK---------TELSDEQ-- 182

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++le++++++e+ll ind+Ld++++++
CP001804_4 183 ----------QRLLEIVESSGESLLLVINDILDFAKADER 212

CP001804_6040: domain 1 of 1, from 1493 to 1558: score 91.2, E = 2.7e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++ HELRTP+++I+g++elL + te s+eq
CP001804_6 1493 AKSDFLASINHELRTPMNGIIGMIELLFD---------TEPSDEQ-- 1528

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
reyl ++ +a++l r+i+d Ld srieag
CP001804_6 1529 ----------REYLGMARTAADQLMRIIRDTLDVSRIEAG 1558

CP001804_3017: domain 1 of 1, from 330 to 395: score 90.0, E = 6.2e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ fl ++sHELRTP++aI+g++ lLl+ ++l + q
CP001804_3 330 AKTTFLTSMSHELRTPMNAIIGMTGLLLD---------GPLASAQ-- 365

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+y+eti++ ++ ll +ind+Ld++++e+g
CP001804_3 366 ----------RDYVETIREGGDALLTIINDILDYAQMESG 395

CP001804_2084: domain 1 of 1, from 1496 to 1561: score 89.3, E = 9.4e-25
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks+fla++ HELRTP+++I+g++elLl t ++ q
CP001804_2 1496 AKSDFLASVNHELRTPMNGIIGMIELLLG---------TRTDATQ-- 1531

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ylet++ +a++l +i+d Ldlsrieag
CP001804_2 1532 ----------RDYLETARTAADQLMGIIRDTLDLSRIEAG 1561

CP001804_2450: domain 1 of 1, from 149 to 217: score 85.8, E = 9.5e-24
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks fla++sHELRTPLt+++gyae+L e+l ++l+ eq
CP001804_2 149 VKSSFLATVSHELRTPLTSVIGYAEMLFEGLA------GPLNKEQ-- 187

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+yl+til+ a++ll+Li lL+ s +e+g
CP001804_2 188 ----------RDYLQTILSKADQLLQLITALLETSILESG 217

CP001804_5123: domain 1 of 1, from 465 to 533: score 84.0, E = 3e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
aks fl n+sHELRTPL+aI+gy+elL+ee+ e++e r
CP001804_5 465 AKSTFLTNMSHELRTPLNAILGYTELLREEA-------VEQGESAR- 503

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
l+ i++++ +ll L+++lLdl+rieag
CP001804_5 504 ----------FSDLDNIHQAGVHLLGLVEELLDLARIEAG 533

CP001804_5836: domain 1 of 1, from 348 to 415: score 82.2, E = 9.7e-23
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++f+an+sHELRTP++ Ir+++e+L + +++s++
CP001804_5 348 VRRDFVANVSHELRTPVSIIRANSETLID---------GAMSDPV-- 383

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++l ++r +erl+rL++dlLdlsr+ea+
CP001804_5 384 -YG-------QRLLAALHRNSERLSRLVDDLLDLSRLEAN 415

CP001804_1838: domain 1 of 1, from 256 to 321: score 82.1, E = 1.1e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ksefla++sHE+RTPL++I+g+ +lL ++l+++q
CP001804_1 256 VKSEFLATISHEMRTPLHGIIGFGDLLAH---------SHLDPQQ-- 291

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l++++++a+ l rLi+d+Ldl++ieag
CP001804_1 292 ----------RGFLDSLRESARLLFRLISDVLDLAQIEAG 321

CP001804_6070: domain 1 of 1, from 154 to 220: score 81.7, E = 1.3e-22
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k flan+sHE+RTPL I+gyae+L + ++e ++++
CP001804_6 154 SKAMFLANISHEMRTPLGNIMGYAEMLAT--------YGEIGDKE-- 190

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +til++++ ll++i+++Ldls ieag
CP001804_6 191 ----------MHFAKTILKSSRDLLSIIDNVLDLSAIEAG 220

CP001804_1979: domain 1 of 1, from 1408 to 1476: score 78.6, E = 1e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
kseflan+sHELRTPL++++ ++ L + +d +ls++q
CP001804_1 1408 YKSEFLANMSHELRTPLNSLLILSRQLAT------NRDNNLSDKQ-- 1446

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey +ti++++ ll+Lin++Ldl++ie+g
CP001804_1 1447 ----------VEYASTIHQSGADLLSLINEILDLAKIESG 1476

CP001804_4515: domain 1 of 1, from 287 to 354: score 76.2, E = 4.8e-21
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ksef++n+sHEL+TPL+ I+++ e+L + ++ q+
CP001804_4 287 LKSEFISNVSHELKTPLSIISMFGEMLAL---------GRTTSAQQS 324

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
ey e+i re++rl rLi+++Ld+++ie g
CP001804_4 325 ----------TEYAEIIWRESQRLARLIDNVLDFAKIERG 354

CP001804_3138: domain 1 of 1, from 2100 to 2166: score 74.7, E = 1.3e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k++fla+l HELR+PL+aIrg+aelLl ++ + +++
CP001804_3 2100 QKDQFLAMLGHELRNPLAAIRGAAELLLL---------SDGGGDEL- 2136

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +i+r++ ++ +Li+ lLd sr g
CP001804_3 2137 ----------ERTRGIIERQSAHMAKLIDGLLDVSRVVLG 2166

CP001804_3001: domain 1 of 2, from 348 to 416: score 74.5, E = 1.5e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak+ f++n+sHELRTPLt ++g +e +l+ +++ + + +l
CP001804_3 348 AKTAFFSNVSHELRTPLTLMLGPLEEALA--------RPAHGLDAAL 386

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re le+++r + rl++L+ +Ld+srieag
CP001804_3 387 ----------REDLEIVHRNGLRLRKLVGTMLDFSRIEAG 416

CP001804_1978: domain 1 of 1, from 195 to 261: score 74.3, E = 1.7e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ef+a+l+HELR+PL+ I +el++ ++l+++ +
CP001804_1 195 RKDEFIAMLAHELRNPLAPIVIGIELMES---------QNLTDPLL- 231

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ et++r++e+l rL++dlLd sri +g
CP001804_1 232 ----------VRIQETMKRQVEHLTRLVDDLLDVSRITSG 261

CP001804_5853: domain 1 of 1, from 1401 to 1469: score 73.7, E = 2.6e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+e++a l+HE R+PL++I+gy+++ ++ + ++e + e
CP001804_5 1401 RKGELMAILAHEVRNPLAGILGYSDIGEA------GDSEEVGLEA-- 1439

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e +++i+ +aerl+rL++++L+l+r e+g
CP001804_5 1440 ----------TEVFKRIRVDAERLRRLVDNVLELARHESG 1469

CP001804_0549: domain 1 of 1, from 80 to 147: score 72.6, E = 5.3e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+s+fl+++sHELRTPLt+Ir+++e+L+++ ++e++
CP001804_0 80 VQSDFLSSVSHELRTPLTSIRMFIETLRDN--------RVTDPEDK- 117

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ l ++re +rl+ L+ +l +l+r+e+g
CP001804_0 118 ----------DQCLALLEREMHRLDGLVARLIELTRMETG 147

CP001804_0266: domain 1 of 1, from 324 to 391: score 71.7, E = 9.2e-20
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a++sHE++ PLt+Irg+aelL++ +++++ ++
CP001804_0 324 YTRSLAADISHEFKSPLTSIRGAAELLQD---------GAADDLPAR 361

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++l i++++erl+r +++lL+lsrie++
CP001804_0 362 ----------ERFLGNIIEDSERLDRTVSRLLELSRIESE 391

CP001804_3672: domain 1 of 1, from 424 to 492: score 70.7, E = 1.7e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++sef++ +sHELRTPLt+I g++++ l ++ ++ +++q
CP001804_3 424 RQSEFVSVVSHELRTPLTSITGALDIVLSGY------SGRVPDKQ-- 462

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl+ ++++ l++L++dlLd + ++ g
CP001804_3 463 ----------QRYLKMARESCAVLNALVDDLLDTANADDG 492

CP001804_3110: domain 1 of 1, from 989 to 1055: score 70.2, E = 2.5e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ fla+lsHELR+PL ++++++++L++ +++ + +
CP001804_3 989 QRDHFLATLSHELRNPLMGLLTATHILRD---------EDMQPAAH- 1025

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++l+ i+r+++++ rL++dlLd sr++
CP001804_3 1026 ----------RRALDLIERQSQQMARLLDDLLDVSRMRRD 1055

CP001804_4517: domain 1 of 1, from 137 to 205: score 69.9, E = 2.9e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k ef++ ++HELRTPLt+I gy++l+ e ++ ++ ++
CP001804_4 137 MKAEFISIAAHELRTPLTSIVGYLDLIHE------GRFGTPPDGM-- 175

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++r a+rl+rL++++Ld srie+g
CP001804_4 176 ----------ERPMASLHRNAHRLRRLVDEMLDVSRIEQG 205

CP001804_4964: domain 1 of 2, from 149 to 215: score 69.2, E = 4.6e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k+ef+an+sH+LRTPLt I+g ++ L ++l + q
CP001804_4 149 LKTEFFANVSHDLRTPLTLIMGPLQKLAQ--------AENLLAGQ-- 185

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ +e++lr+a+ ll nd+Ld +r++ag
CP001804_4 186 ----------RQDIEVALRSANTLLGRMNDILDVARLDAG 215

CP001804_3001: domain 2 of 2, from 1024 to 1090: score 69.2, E = 4.7e-19
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+efla+l+HELR+PL+ +r+ +elL ++ +eq
CP001804_3 1024 RKDEFLATLAHELRNPLAPLRTGLELLSV--------AGADAAEQ-- 1060

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ l+ + r++ ++ rL++dlLd+ ri+ g
CP001804_3 1061 ----------ARTLDMMTRQVSHMVRLVDDLLDMNRIRRG 1090

CP001804_6417: domain 1 of 1, from 541 to 607: score 67.4, E = 1.5e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ +a+l HELR+PL++Ir+++elL+ ++ s+ ++
CP001804_6 541 QKDIYMAMLGHELRNPLSSIRAAVELLEL---------GPTSDVDL- 577

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++ +++ r++ ++ +L++ lLd sr+e g
CP001804_6 578 ----------QRIHKSLMRQTSHMAKLVDGLLDVSRLELG 607

CP001804_1316: domain 1 of 1, from 1384 to 1450: score 65.8, E = 4.4e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+efla+l HELR+PL+aIr+++elL++ +l+
CP001804_1 1384 QKDEFLAMLGHELRNPLAAIRTASELLRR----------KLGGNP-- 1418

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e+ ++ e+++r++ ++ +L++ lLd+sri g
CP001804_1 1419 --------EFTRMQEVLDRQTLHMAKLLDGLLDISRIIRG 1450

CP001804_4425: domain 1 of 1, from 278 to 348: score 65.6, E = 4.8e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+ f+ n+sHE+RTPL++I+g +elLl ++++ + ++ ++
CP001804_4 278 ARFSFVTNMSHEIRTPLHGILGSTELLLG-----SLKSMDIDPMDI- 318

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +ti+ ++++l +Li d++d+s i+ +
CP001804_4 319 ----------EKHAKTIQTCGQHLHALITDIMDFSHIDGN 348

CP001804_5095: domain 1 of 1, from 1332 to 1398: score 65.0, E = 7.4e-18
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+efla+l HELR+PL+aIr +ae L + +++q+
CP001804_5 1332 QKDEFLAMLGHELRNPLAAIRSAAEFLHL---------HGDDSPQL- 1368

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ +++r++ ++ +L++ lLd+sri +g
CP001804_5 1369 ----------ERTRVIVERQSAHMAKLLDGLLDISRIISG 1398

CP001804_4488: domain 1 of 1, from 1087 to 1155: score 63.6, E = 1.8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++fla+lsHELR+PL++I ++ +L ag ++l+++
CP001804_4 1087 RRDRFLAMLSHELRNPLAGITSAVGVLSL------AGKEKLPPPA-- 1125

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+++e+++r++ ++ +L++dlLd +r
CP001804_4 1126 ----------LRAFEVLKRQTSHMAHLLDDLLDVTRFVRD 1155

CP001804_5399: domain 1 of 1, from 484 to 554: score 62.6, E = 3.5e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a +e+ a+l+HE+R+PL aI+g+a+lL d+e ++ +
CP001804_5 484 AIGELSAGLAHEIRNPLGAIKGAAQLLVG-------PDGEPAPPSA- 522

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e e++++i++e++rl++ ++++Ld++r+
CP001804_5 523 --------ESVEFVQIIIEEVDRLNNVVSQFLDYARATGS 554

CP001804_5493: domain 1 of 1, from 381 to 446: score 62.5, E = 3.8e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ +++la++ H+L+TP+t I+gya+l+ +++qr
CP001804_5 381 SIGRMLASVLHDLKTPMTIISGYAQLMAQ----------IDDADQR- 416

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ y+e ilr+ + + + +++L ++r e++
CP001804_5 417 ----------EAYVEQILRQFDLMKGMTQEVLLFARGESE 446

CP001804_5686: domain 1 of 1, from 379 to 445: score 61.8, E = 6e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a + ++a+++HE ++PLt+++gya+lLle d + +
CP001804_5 379 AVGTMAASVAHEVNNPLTTVLGYAKLLLE--------DKPEQHAD-- 415

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r le i +eaer+ +i lLd+sr e
CP001804_5 416 ----------RPGLELIAEEAERMKGIIGTLLDYSRSERA 445

CP001804_3083: domain 1 of 1, from 234 to 300: score 61.3, E = 8.2e-17
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++e+ a l+HE+R+PL++++g+a+lL e +l+e+ r+
CP001804_3 234 TLGEMSAVLAHEIRNPLASLKGHAQLLAE----------ALPEDGRP 270

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ ea rl++L +dlL++ r ++
CP001804_3 271 ----------KAKADRVVAEAIRLEQLTSDLLQFVRTGEI 300

CP001804_4673: domain 1 of 1, from 367 to 433: score 60.3, E = 1.5e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a+++HE+R+PL+aI+g +elL++ + +e+
CP001804_4 367 VVGTLAAGVAHEIRNPLAAISGSIELLQT--------MPSVDEDN-- 403

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + +++ re+erl++Li+dlLd++ +
CP001804_4 404 ----------RMLMDIVTREIERLDNLIRDLLDYTNPRPR 433

CP001804_4574: domain 1 of 1, from 146 to 211: score 59.5, E = 2.6e-16
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++l +sH++R PL +I +elL+e +++q
CP001804_4 146 FEQRLLGIVSHDMRSPLGTIVIGLELLRE---------ICDDAKQ-- 181

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+e++ +++r++ r+ rL++dlLd++ +++g
CP001804_4 182 ----------QEIIGRVIRSTTRMTRLVEDLLDMTHARQG 211

CP001804_2982: domain 1 of 1, from 178 to 244: score 56.0, E = 2.6e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ak++fla l HELR+PL+a+ +elL ++ +++ r
CP001804_2 178 AKDRFLAVLGHELRNPLAALTSSVELLAH---------GAIDDQRR- 214

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ r++ +l++L++dlLd +ri +g
CP001804_2 215 ----------DWIHDSMARQLAQLRSLVDDLLDVTRIAQG 244

CP001804_4964: domain 2 of 2, from 591 to 658: score 55.7, E = 3.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
ks+fl ++ HELR PL+++ + +e L + ++++ +
CP001804_4 591 LKSDFLGMVTHELRSPLASLALQLERLDM---------MDANPAPA- 627

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ + +++ +++ rl++Li+ lL++ r + g
CP001804_4 628 ---------VHTLRQRMNSSIGRLSSLIESLLEYVRVQRG 658

CP001804_2131: domain 1 of 1, from 352 to 418: score 55.4, E = 3.8e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e l ++H+LRTPL+++ ++a +l ++ ++
CP001804_2 352 SREEVLGIVAHDLRTPLSVVAMTAGEALS---------EAGPDSRS- 388

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +++lr ++r++ Li+dlLd+s+ie+g
CP001804_2 389 ----------RARASRLLRNTHRMELLIRDLLDFSQIETG 418

CP001804_5821: domain 1 of 2, from 287 to 353: score 54.7, E = 6.2e-15
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ +l++++HE R+PL +I ++a +L++ + ++++r
CP001804_5 287 RMQLMLSGIAHEVRNPLGGIELFAGILRD---------ELGPDDER- 323

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + +i+re+ +l + +n +L+++r
CP001804_5 324 ----------RSHVARIEREIGYLGEVVNAFLEYARRPPL 353

CP001804_5473: domain 1 of 1, from 322 to 390: score 53.5, E = 1.4e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f ++sH+LR PL aI g++ lL +++ +++ +e
CP001804_5 322 ELEAFSYSVSHDLRAPLRAIEGFSRLLFDRY-------HDQLDERG- 360

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ yl +++++++r++ Li+dlL lsr+
CP001804_5 361 ----------QNYLTRVREAGQRMNLLIEDLLKLSRMSRS 390

CP001804_3163: domain 1 of 1, from 263 to 329: score 52.5, E = 2.5e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ f+a ++HEL TPL++I + a +L + + s+e +
CP001804_3 263 TIGLFAAEIAHELGTPLNVIAARARTLNR---------KANSPEAV- 299

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++i +++ r+ r+i++ Ld +r+++g
CP001804_3 300 ----------QKNADIISEQVARITRIIQQTLDHARLDSG 329

CP001804_4708: domain 1 of 1, from 433 to 500: score 51.8, E = 4.1e-14
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fla+l HELR+PL+aI ++ lL+ + ++ +++
CP001804_4 433 YKDQFLAMLGHELRNPLSAICNATRLLEVLV-------QHNDAKL-- 470

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++ ++++ r++e l L++dlLd sr g
CP001804_4 471 ----------QRPVDVLARQSENLTLLVDDLLDVSRVARG 500

CP001804_3287: domain 1 of 1, from 1657 to 1723: score 50.2, E = 1.2e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k++fla+l H LR+PL+a+r ++e L+ +++ +
CP001804_3 1657 QKDDFLAMLGHKLRNPLAAVRHATEFLQL---------KSPDPQRM- 1693

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++++ +++r++ ++ rLi+ lLd + + g
CP001804_3 1694 ----------ARLTAVLDRQGAQMARLIDGLLDVTSMVRG 1723

CP001804_4572: domain 1 of 1, from 539 to 607: score 49.3, E = 2.1e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+ +sH+L+ PL aI ya L ++ +e+ +++
CP001804_4 539 DLDAFAYVASHDLKEPLRAIANYAGFLTQDY-------GERLDDEG- 577

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++le + r ++rl++Li+ lL +sr++
CP001804_4 578 ----------RDMLEALVRLSDRLRQLIDSLLRFSRMGRA 607

CP001804_2572: domain 1 of 1, from 522 to 584: score 48.9, E = 2.7e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++ +a++ H+LR PLt+Irg +el l++ + +++el++ +
CP001804_2 522 QIGRHTAGIVHDLRSPLTVIRGSLELVLDNTE----SRGELTDSE-- 562

peLRledpeyreyletilreaerllrLindlL<-*
r++l+ ++++ae++ ++i+ +L
CP001804_2 563 ----------RKILSNAYQCAEQMTDMISLIL 584

CP001804_6374: domain 1 of 1, from 180 to 246: score 48.3, E = 3.9e-13
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ f+++++H L+ PL++++g+a+l +e+ +l e+
CP001804_6 180 ELDAFARTVAHNLKDPLNGVLGFADLVVNEF--------TLEEDA-- 216

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++yl i ++a+r++++ ++lL l+r++a
CP001804_6 217 ----------ERYLTHIVESARRMNDITEELLLLARLRAS 246

CP001804_3111: domain 1 of 1, from 197 to 263: score 46.9, E = 1e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e+++ ++HE+R PL ++++ +el+++ e + +
CP001804_3 197 QREEMMRVVAHEMRSPLQSMLLISELCQT---------REDDLTLL- 233

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + +++ r ++r+lrLi+dl dls i+ g
CP001804_3 234 ----------RSMPDRVVRMVQRILRLIEDLSDLSNIDLG 263

CP001804_5362: domain 1 of 1, from 308 to 374: score 46.6, E = 1.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++ + ++ H+LR P+ aI +elL+ el ++e
CP001804_5 308 ALGQAMGYVVHDLRSPIGAIVNSTELLRYEL--------GEDSES-- 344

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+l++i+++a+ + ++d+Ld++r + +
CP001804_5 345 ----------RELLDIIEEAADNAIAVVDDVLDFTREGIP 374

CP001804_3376: domain 1 of 1, from 248 to 323: score 46.3, E = 1.5e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++a++ HE+++PL+ ++g++e L e++ +e+se +
CP001804_3 248 TVGTLAAGIVHEINNPLAYVMGNLEFLIEQV-------EEWSEGV-A 286

peLR..ledpeyreyletilreaerllrLindlLdlsrieag<-*
+e R++l +l+ +++ a r++r+++dl+++sr ++
CP001804_3 287 DEYRseL-----LPALREARSGAVRMDRIVRDLRTFSRRDED 323

CP001804_6650: domain 1 of 1, from 244 to 310: score 46.0, E = 1.8e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ +a l+HE +PL++I+ +++l+ ++ s +q+
CP001804_6 244 ILGRAAAVLAHEVSNPLASIKSTLQLIGS---------GNFSRKQI- 280

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++y++++lre+erl+ ++ L + r +
CP001804_6 281 ----------EDYISRALREIERLSTIVKSYLSIVRPPSK 310

CP001804_1271: domain 1 of 1, from 408 to 476: score 45.8, E = 2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++e +sH+L+ PL +I+g+ lL +++ +++ ++
CP001804_1 408 ELEEYGHIISHDLKEPLRTISGFMGLLGKKY-------GDRLDDRG- 446

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+y++++ ++ r+++Li+dl+ +sr a+
CP001804_1 447 ----------RDYVDRAVAASVRMRQLIDDLRSYSRVAAQ 476

CP001804_2180: domain 1 of 1, from 247 to 313: score 43.5, E = 9.2e-12
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ ++++ ++H+L TPL++++g a ++ +++ +e
CP001804_2 247 TMARLASVIAHDLGTPLNVVSGRAMMISS--------TPDCAPEI-- 283

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
++i ++a+ + rLi+ Ld++r ++
CP001804_2 284 ----------VSDARIIGEQANNMTRLIRKTLDYARRGEL 313

CP001804_6642: domain 1 of 1, from 297 to 372: score 43.1, E = 1.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a +++ a + HE R+PL++I +++elL e +d + +++el ee
CP001804_6 297 AVGKMSAVITHEVRNPLSSIGLNTELLTELVDEGfAEREDELAEEA- 342

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r + i e++rl ++ ++ L+++r+ +
CP001804_6 343 -----------RSLCAAITTEVDRLAAITEEYLQFARLPKP 372

CP001804_2866: domain 1 of 1, from 269 to 337: score 42.6, E = 1.6e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +f +sH+L PL +++gy+ l++eel ++ + +++
CP001804_2 269 ELLQFNYRVSHDLLAPLKTVLGYLNLCEEEL-------ADGNLDEM- 307

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++ +erl L++d+L l+r++a
CP001804_2 308 ----------SSFHAKMRLNLERLGGLVEDVLNLARADAV 337

CP001804_2455: domain 1 of 1, from 609 to 675: score 42.4, E = 1.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + + +++HEL++PLt+I++ ae+L++ +
CP001804_2 609 MAAQIAGTAAHELNQPLTSIQACAEMLKR---------QSEEGAP-- 644

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
y +y+++i +++er+ +L++++ ++ +
CP001804_2 645 ---------YMRYVDSIVDQVERMASLVRRIGHITMFHTK 675

CP001804_6518: domain 1 of 1, from 212 to 287: score 42.4, E = 1.9e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+l HE+++PLt +++ +e+++ el+ + ++ ++++
CP001804_6 212 ALGRLAAGLGHEINNPLTFMIASLEAIQGELE----SFADTMPDELS 254

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+eL + +l+t l a+r+ ++++++ ++r +
CP001804_6 255 DEL-------ASLLRTSLVGADRIAQIVRNIKRFTRPSDE 287

CP001804_2456: domain 1 of 1, from 329 to 405: score 42.3, E = 2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldk.v.lagdtelseeq
+++++a++ HEL++PLt+I ya+ L+ +l ++ + ++ e ++ +
CP001804_2 329 TLGQLAAGVVHELNNPLTSIVVYASYLEGKLSRgAhRGEALEVDPGD 375

rlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e l++i +a+r+++L ++l ++++ ++
CP001804_2 376 ------------VEKLRRIGASAQRISNLARELVQYAKPAHE 405

CP001804_4290: domain 1 of 1, from 346 to 417: score 42.0, E = 2.5e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
a +e ++ l+HE+++PLt I++++e+L++ + + + + +e
CP001804_4 346 AWQEIARRLAHEIKNPLTPIQMAVETLRK----TfAKKHPSFDEIF- 387

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
e + t+l+e+ rl r++ ++ +++r+ +
CP001804_4 388 -----------DESTATVLEETARLKRIVGEFSQFARMPKP 417

CP001804_2078: domain 1 of 1, from 167 to 240: score 41.6, E = 3.2e-11
*->akseflanlsHELRTPLtaIrgyaelLleeldkv.lagdtelseeqr
+++ f +++H+LR+ L + g+a+lLle++ ++ g++ ++ ++
CP001804_2 167 ELDAFSHMVAHDLRNALVRVVGFADLLLERV--EdYYGSAGWDGQT- 210

lpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r+ l++i+++a ++++ i+ lL l+ i
CP001804_2 211 -----------RDDLQSIQDSALQMQEVIDSLLLLAGISRR 240

CP001804_2163: domain 1 of 1, from 174 to 242: score 39.8, E = 1e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+k+ +la ++H+L P t I+g++elL++ + ++l+ ++
CP001804_2 174 SKNLLLAVMAHDLMGPFTPILGFSELLRDSA-------ETLPRTEI- 212

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
re+ i+ +a+++ +L+++lLd +r+e+
CP001804_2 213 ----------RELGGGIHLAAQHCVELLQNLLDWARLEQM 242

CP001804_5579: domain 1 of 1, from 144 to 219: score 39.5, E = 1.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldk....v.lagdtels
++++a+++HE+++PL+ I++ a+ L+e+++k + v+++ + +l
CP001804_5 144 TVGQLVAGIAHEINNPLSLILADADFLREQVEKlgaaVpAPVRKDL- 189

eeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ ++ i++ +++++ ++dl ++r e +
CP001804_5 190 ---------------QASISEIQQGVDHIRGVVRDLGAFARSEDE 219

CP001804_4926: domain 1 of 1, from 424 to 492: score 39.1, E = 1.6e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ +f+ +sH+L PL ++r+++elL +++ ++ +e
CP001804_4 424 ELAQFAFVASHDLQEPLRTVRTFTELLGRRYA------DAFDERG-- 462

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r l +i + r++ L++dlL +sr +
CP001804_4 463 ----------RTWLASISNGMARMRTLVDDLLSYSRVGRI 492

CP001804_5201: domain 1 of 1, from 184 to 251: score 39.0, E = 1.7e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++l++++H+LR+PL +++ ++ Ll+++ + lsee+
CP001804_5 184 LNNRLLRMAAHDLRNPLLVLSIGCSFLLADA-------DGLSEEH-- 221

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +l+ l+ + ++rLi+ + dl+ +g
CP001804_5 222 ----------RSLLQENLDTCDFMNRLIDGIVDLAEVSSG 251

CP001804_2346: domain 1 of 1, from 144 to 211: score 38.9, E = 1.9e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++++ + H++R PL+++++ a++L + dtel++
CP001804_2 144 FEQRLVGVVGHDMRSPLSVLSMVADMLGD-------ADTELPPHL-- 181

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r++ +++r+a l +L +dlL + ++g
CP001804_2 182 ----------RRLGGRVKRAATTLTHLAEDLLLVAHGRSG 211

CP001804_5748: domain 1 of 1, from 403 to 470: score 36.6, E = 8.2e-10
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++ +++H+L++ L++I g+ +++l++l ++ +ee+
CP001804_5 403 ALGLLAGGVAHDLNNILSGIAGLPDVILADL-------PPEDEET-- 440

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
r +let+++++ r + + dl+++s+ a
CP001804_5 441 ----------RMLLETVKESGIRAAAVVADLMTISKGIAA 470

CP001804_1781: domain 1 of 1, from 294 to 359: score 36.1, E = 1.1e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ fla+++H+ +TP++++ + ++ L + +l++e
CP001804_1 294 AMEIFLADVAHDVKTPMASMHLSVDELAA---------LPLPAEG-- 329

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ +++++ ++ +l++L +l +r++ g
CP001804_1 330 ----------EALVRRLSGDVVYLRNLFANLALAARLRDG 359

CP001804_2178: domain 1 of 1, from 1554 to 1627: score 34.9, E = 2.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
k++fl+ ++H+L++ L+ I g+++++l+e +e +e+
CP001804_2 1554 DKEKFLSLMAHDLKNALNQIVGMTDVMLDEI-------DEIEPEE-- 1591

peLRledp.eyreyletilreaerllrLindlLdlsrieag<-*
+ p+e+r +le++ + ae + +L+ +lL+ sr+++g
CP001804_2 1592 -----FEPeEFRGMLEKLGQTAEGCTDLLINLLTWSRLQSG 1627

CP001804_2573: domain 1 of 1, from 284 to 350: score 34.5, E = 3.2e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a ++++ +++H++++ LtaI +ael++ + s +
CP001804_2 284 AVGQLAGGIAHDFNNLLTAIACHAELAQQ---------SVESGSPA- 320

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ le i +++++ +L +++L +sr +
CP001804_2 321 ----------AFDLEQIMHAIRHAAELTQQILVFSRRRVT 350

CP001804_2284: domain 1 of 1, from 676 to 755: score 34.4, E = 3.5e-09
*->akseflanlsHELRTPLtaIrgyaelLleeldk.......v.lagdt
+ ++++a+++HE+++P++aI ++ L+e + ++ ++a+++
CP001804_2 676 SIGQLVAGIAHEINNPVNAIVNTVGPLEE---AavtvmssDdSAERE 719

elseeqrlpeLRledpeyreyletilreaerllrLindlLdlsrieag<-
e+ e+ r+++++++r aer ++++ l +sr + +
CP001804_2 720 EAAEDV------------RDMIRVVKRGAERTKAIVRALHNYSRTDDE 755

*

CP001804_2 - -

CP001804_5641: domain 1 of 1, from 621 to 698: score 32.2, E = 1.5e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+++ ++a+++HE+++PLt ++g+++ +e l+ ++d+ + +++ +
CP001804_5 621 SLGTMAAGVAHEINNPLTWLMGNVSYVRESLE--ELRDEIALDDDSA 665

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L ++l l aer++ +++dl ++r ++
CP001804_5 666 DDL-------DKALADSLVGAERIRTIVQDLKLFARDRED 698

CP001804_0222: domain 1 of 1, from 262 to 337: score 31.9, E = 1.8e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a+++++a+l HE+++PL+ ++g +e+L + e ++
CP001804_0 262 ALGRMAAGLGHEINNPLNFVSGSLEMLDA--------------ELMR 294

peLRl...edpeyreyletilreaerllrLindlLdlsrieag<-*
++Rl+++e e+l+t+ + r+ ++++ + + r +
CP001804_0 295 VRGRLredEWARMGEMLHTAAAGVGRIAQIVSGIQFFDRPTEI 337

CP001804_1874: domain 1 of 1, from 246 to 319: score 31.4, E = 2.4e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
+ + ++a+l+HE+++PL+ + g++ L e l+ + + qr
CP001804_1 246 SANILAAGLAHEINNPLAFVVGNLGYLAE-----LLPEVVSEPRQRE 287

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ L + l + + aer +r++ dl+ ls
CP001804_1 288 TVL--------RVLADANEGAERVDRIVGDLRLLSSGARA 319

CP001804_6216: domain 1 of 1, from 281 to 356: score 30.6, E = 4e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
a++ ++a+++HE+++PLt ++g++e L++ ld + + + +
CP001804_6 281 ALGTLAAGVAHEINNPLTWLMGNVECLKALLD----DHASMLASSMT 323

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+eL e++ +++ +er++r++ l ++r ++
CP001804_6 324 DEL-------GEIVVEMRDGTERIRRIVAGLKPFTRSDED 356

CP001804_4471: domain 1 of 1, from 1528 to 1617: score 30.3, E = 5.1e-08
*->akseflanlsHELRTPLtaIrgyaelLleeldk..............
+++ ++a+++HELR+PL+ + +a l + ++ +++ + ++
CP001804_4 1528 SLGSLAAGIAHELRNPLNFVNNFARLSIK---Higslgttlagvmen 1571

..v.lagdtelseeqrlpeLRledpeyreyletilreaerllrLindlLd
++++a++ e+s ++ l++i++ ++r++ +i+ +L
CP001804_4 1572 leTdTAHRVEQSLRHL-----------TLNLSKIEEHGQRIDGIIRSMLA 1610

lsrieag<-*
+r ++g
CP001804_4 1611 HAREGSG 1617

CP001804_5613: domain 1 of 1, from 183 to 251: score 28.1, E = 2.1e-07
*->akseflanlsHELRTPLtaIrgyaelLleeldkvlagdtelseeqrl
++ f+++lsH+LR+PL +++ ++ lL+e d+ ++ ++++
CP001804_5 183 DLNMFARALSHDLRQPLQTVSSLVTLLRE--------DHGATLDEQA 221

peLRledpeyreyletilreaerllrLindlLdlsrieag<-*
+ i +++ r+++++ l l + +
CP001804_5 222 ----------CTDIAHIADASARMEQILGGLTRLFQVTNL 251


Histogram of all scores:
score obs exp (one = represents 22 sequences)
----- --- ---
-15 1 0|=
-14 10 0|=
-13 40 5|*=
-12 161 153|======*=
-11 466 796|====================== *
-10 960 1477|============================================ *
-9 1145 1525|===================================================== *
-8 1254 1142|===================================================*=====
-7 928 720|================================*==========
-6 686 414|==================*=============
-5 441 227|==========*==========
-4 250 121|=====*======
-3 122 64|==*===
-2 76 33|=*==
-1 40 17|*=
0 22 9|*
1 9 4|*
2 8 2|*
3 3 1|*
4 1 0|=
5 0 0|
6 2 0|=
7 0 0|
8 0 0|
9 1 0|=
10 1 0|=
11 0 0|
12 0 0|
13 1 0|=
14 1 0|=
15 0 0|
16 1 0|=
> 17 89 -|=====


% Statistical details of theoretical EVD fit:
mu = -8.9758
lambda = 0.6525
chi-sq statistic = 1392.9147
P(chi-square) = 0

Total sequences searched: 6719

Whole sequence top hits:
tophits_s report:
Total hits: 82
Satisfying E cutoff: 82
Total memory: 23K

Domain top hits:
tophits_s report:
Total hits: 83
Satisfying E cutoff: 83
Total memory: 54K


Acknowledgements:

This research is funded by:

Developed by: