Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
41 projects found  

2 accessions found for Rhodothermus marinus DSM 4252  

Data for CP001807  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001807.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001807_2407 CDS_2831991-2830192 60.0 1.5e-17 2
CP001807_2198 CDS_2592789-2590825 44.6 5.1e-13 1
CP001807_0991 CDS_1155302-1152399 44.3 6.2e-13 1
CP001807_1103 CDS_1296214-1298199 40.5 7.9e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001807_2407 2/2 386 453 .. 1 70 [] 53.5 1.2e-15
CP001807_2198 1/1 438 505 .. 1 70 [] 44.6 5.1e-13
CP001807_0991 1/1 762 821 .. 1 63 [. 44.3 6.2e-13
CP001807_1103 1/1 462 525 .. 5 70 .] 40.5 7.9e-12

Alignments of top-scoring domains:
CP001807_2407: domain 2 of 2, from 386 to 453: score 53.5, E = 1.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+vg L+++ l l++a++ + + + +++ l+e+
CP001807_2 386 ERRRIARELHDEVGALLTSAQLCLGMAQTDV--SETQQTLAQNLQEA 430

relarealaevRrllgdLRpaal<-*
r+l+++ +e+R+l +LRp+ l
CP001807_2 431 RALIDRLSQEIRQLTLQLRPPLL 453

CP001807_2198: domain 1 of 1, from 438 to 505: score 44.6, E = 5.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ I ++LHD++gQ+L++++l ++ ++r+l ++ + +++l+e+
CP001807_2 438 ERRSIGQDLHDGLGQMLTGMALISQSLARRL--AAQGRPEARELEEL 482

relarealaevRrllgdLRpaal<-*
el+r+a +++R l+++L p +l
CP001807_2 483 TELIRQADRQARTLARGLIPVEL 505

CP001807_0991: domain 1 of 1, from 762 to 821: score 44.3, E = 6.2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R++R+LHD+vg +L++i l + +r+l +d e++ +l+++
CP001807_0 762 ERRRLSRDLHDEVGATLTSIYFLLTTSLRQL---SDREALSHRLHQA 805

relarealaevRrllg<-*
+elar+al+++R ll+
CP001807_0 806 AELARTALDQLRLLLW 821

CP001807_1103: domain 1 of 1, from 462 to 525: score 40.5, E = 7.9e-12
*->IARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirela
I R+LHD+vgQ L+++++ +e ++++l +++ e++e ++ + + a
CP001807_1 462 IGRDLHDGVGQLLTSVRMLSENLATRL--QAEQHELAELAQKVVRFA 506

realaevRrllgdLRpaal<-*
+ea + vR + ++L pa+l
CP001807_1 507 QEASEGVRTIYRGLTPAQL 525


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 4 0|=
-13 9 0|==
-12 33 30|====*
-11 45 253|======= *
-10 171 588|========================= *
-9 306 667|============================================ *
-8 376 514|====================================================== *
-7 393 323|==============================================*==========
-6 365 183|==========================*==========================
-5 399 98|=============*===========================================
-4 216 51|=======*=======================
-3 159 26|===*===================
-2 87 13|=*===========
-1 76 6|*==========
0 46 3|*======
1 27 1|*===
2 14 0|==
3 10 0|==
4 12 0|==
5 5 0|=
6 1 0|=
7 2 0|=
8 1 0|=
9 1 0|=
10 2 0|=
11 0 0|
12 1 0|=
> 13 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4110.3989
P(chi-square) = 0

Total sequences searched: 2766

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: