Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Streptosporangium roseum DSM 43021  

Data for CP001814  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001814.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001814_1676 CDS_1863968-1862814 101.6 2.6e-29 1
CP001814_5577 CDS_6473315-6474514 100.8 4.6e-29 1
CP001814_8365 CDS_9701568-9702710 97.1 5.6e-28 1
CP001814_5308 CDS_6153401-6154696 92.8 1e-26 1
CP001814_5702 CDS_6610102-6611118 88.9 1.5e-25 1
CP001814_4521 CDS_5275237-5274149 87.9 2.9e-25 1
CP001814_1608 CDS_1794246-1795526 86.4 7.7e-25 1
CP001814_0086 CDS_95107-92927 86.2 9.1e-25 2
CP001814_3126 CDS_3534144-3532852 85.5 1.5e-24 1
CP001814_5102 CDS_5919246-5920472 85.1 1.9e-24 1
CP001814_3902 CDS_4516595-4515540 84.9 2.1e-24 1
CP001814_0870 CDS_942856-944079 84.9 2.2e-24 1
CP001814_1455 CDS_1613020-1611908 84.7 2.5e-24 1
CP001814_0469 CDS_511860-512981 83.3 6.3e-24 1
CP001814_8371 CDS_9706142-9707401 82.2 1.3e-23 1
CP001814_5008 CDS_5818729-5819832 77.1 4.3e-22 1
CP001814_0295 CDS_315163-313985 77.1 4.4e-22 1
CP001814_7217 CDS_8398485-8399651 76.9 4.9e-22 1
CP001814_8374 CDS_9710036-9708957 76.9 4.9e-22 1
CP001814_6927 CDS_8062567-8061314 76.9 4.9e-22 1
CP001814_0778 CDS_847310-848548 76.7 5.7e-22 1
CP001814_2220 CDS_2487522-2486284 75.9 9.7e-22 1
CP001814_4312 CDS_5027607-5026465 75.9 1e-21 1
CP001814_3959 CDS_4571778-4572938 74.9 2e-21 1
CP001814_4274 CDS_4983349-4982195 74.8 2e-21 1
CP001814_3843 CDS_4452263-4453966 74.4 2.7e-21 1
CP001814_6838 CDS_7959119-7960258 74.1 3.2e-21 1
CP001814_0068 CDS_72206-73435 74.1 3.3e-21 1
CP001814_4058 CDS_4700580-4701776 74.1 3.4e-21 1
CP001814_2584 CDS_2917545-2918360 73.1 6.5e-21 1
CP001814_8887 CDS_10283305-10281779 73.1 6.6e-21 1
CP001814_8145 CDS_9449905-9451128 72.6 9.4e-21 1
CP001814_0516 CDS_562251-560188 72.4 1.1e-20 1
CP001814_5879 CDS_6819783-6818557 72.0 1.4e-20 1
CP001814_4464 CDS_5198693-5197494 71.7 1.7e-20 1
CP001814_3082 CDS_3492931-3491744 69.5 7.7e-20 1
CP001814_3896 CDS_4509094-4510218 69.4 8.2e-20 1
CP001814_0187 CDS_200096-198822 69.3 8.7e-20 1
CP001814_1581 CDS_1767946-1769265 68.6 1.4e-19 1
CP001814_0211 CDS_226139-225000 67.9 2.2e-19 1
CP001814_2513 CDS_2836358-2834406 67.7 2.5e-19 1
CP001814_4378 CDS_5092583-5091471 67.1 3.8e-19 1
CP001814_2446 CDS_2765725-2766927 65.5 1.1e-18 1
CP001814_7059 CDS_8218789-8216555 65.3 1.3e-18 3
CP001814_4227 CDS_4927734-4928894 64.7 1.9e-18 1
CP001814_6229 CDS_7238946-7241015 64.3 2.5e-18 1
CP001814_0246 CDS_264860-266023 62.7 7.6e-18 1
CP001814_1614 CDS_1800921-1799728 62.3 1e-17 1
CP001814_1861 CDS_2064218-2065312 60.7 3e-17 1
CP001814_5830 CDS_6761224-6759977 60.7 3e-17 1
CP001814_3207 CDS_3628799-3630760 59.1 8.8e-17 2
CP001814_0571 CDS_620774-619656 58.9 9.8e-17 1
CP001814_1379 CDS_1515894-1513819 58.7 1.2e-16 1
CP001814_4157 CDS_4842756-4844132 58.5 1.3e-16 1
CP001814_3133 CDS_3542792-3541674 57.9 1.9e-16 1
CP001814_3537 CDS_4068882-4067767 57.8 2.1e-16 2
CP001814_0517 CDS_563753-562368 57.4 2.8e-16 1
CP001814_1835 CDS_2033486-2034661 56.1 6.5e-16 1
CP001814_2421 CDS_2737757-2736540 55.5 9.9e-16 1
CP001814_5806 CDS_6733927-6732716 55.0 1.4e-15 1
CP001814_7296 CDS_8488339-8486576 54.0 2.8e-15 2
CP001814_3397 CDS_3902936-3904711 53.9 3e-15 1
CP001814_5865 CDS_6802343-6801096 52.6 6.9e-15 1
CP001814_7831 CDS_9099195-9098122 52.2 9.3e-15 1
CP001814_2511 CDS_2832848-2830686 51.7 1.3e-14 1
CP001814_4381 CDS_5096503-5094512 49.5 5.9e-14 1
CP001814_7738 CDS_8985053-8986798 47.2 2.8e-13 1
CP001814_4595 CDS_5362104-5360404 42.5 6.9e-12 1
CP001814_2362 CDS_2670954-2669149 42.3 7.8e-12 1
CP001814_3394 CDS_3900039-3898864 41.9 1e-11 1
CP001814_8297 CDS_9619432-9618335 36.3 4.5e-10 1
CP001814_4691 CDS_5476410-5475892 34.6 1.5e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001814_1676 1/1 175 242 .. 1 70 [] 101.6 2.6e-29
CP001814_5577 1/1 194 261 .. 1 70 [] 100.8 4.6e-29
CP001814_8365 1/1 182 249 .. 1 70 [] 97.1 5.6e-28
CP001814_5308 1/1 205 272 .. 1 70 [] 92.8 1e-26
CP001814_5702 1/1 144 208 .. 1 70 [] 88.9 1.5e-25
CP001814_4521 1/1 167 233 .. 1 70 [] 87.9 2.9e-25
CP001814_1608 1/1 237 304 .. 1 70 [] 86.4 7.7e-25
CP001814_3126 1/1 222 289 .. 1 70 [] 85.5 1.5e-24
CP001814_5102 1/1 212 279 .. 1 70 [] 85.1 1.9e-24
CP001814_3902 1/1 173 240 .. 1 70 [] 84.9 2.1e-24
CP001814_0870 1/1 182 249 .. 1 70 [] 84.9 2.2e-24
CP001814_1455 1/1 174 241 .. 1 70 [] 84.7 2.5e-24
CP001814_0469 1/1 178 245 .. 1 70 [] 83.3 6.3e-24
CP001814_8371 1/1 185 253 .. 1 70 [] 82.2 1.3e-23
CP001814_5008 1/1 163 230 .. 1 70 [] 77.1 4.3e-22
CP001814_0295 1/1 186 253 .. 1 70 [] 77.1 4.4e-22
CP001814_7217 1/1 177 244 .. 1 70 [] 76.9 4.9e-22
CP001814_8374 1/1 162 229 .. 1 70 [] 76.9 4.9e-22
CP001814_6927 1/1 210 278 .. 1 70 [] 76.9 4.9e-22
CP001814_0778 1/1 210 276 .. 1 70 [] 76.7 5.7e-22
CP001814_2220 1/1 223 290 .. 1 70 [] 75.9 9.7e-22
CP001814_4312 1/1 178 245 .. 1 70 [] 75.9 1e-21
CP001814_3959 1/1 181 244 .. 1 70 [] 74.9 2e-21
CP001814_4274 1/1 184 250 .. 1 70 [] 74.8 2e-21
CP001814_3843 1/1 344 409 .. 1 70 [] 74.4 2.7e-21
CP001814_6838 1/1 183 249 .. 1 70 [] 74.1 3.2e-21
CP001814_0068 1/1 204 270 .. 1 70 [] 74.1 3.3e-21
CP001814_4058 1/1 190 257 .. 1 70 [] 74.1 3.4e-21
CP001814_2584 1/1 63 130 .. 1 70 [] 73.1 6.5e-21
CP001814_8887 1/1 214 281 .. 1 70 [] 73.1 6.6e-21
CP001814_8145 1/1 178 245 .. 1 70 [] 72.6 9.4e-21
CP001814_0516 1/1 497 564 .. 1 70 [] 72.4 1.1e-20
CP001814_5879 1/1 187 253 .. 1 70 [] 72.0 1.4e-20
CP001814_4464 1/1 198 265 .. 1 70 [] 71.7 1.7e-20
CP001814_3082 1/1 206 273 .. 1 70 [] 69.5 7.7e-20
CP001814_3896 1/1 188 253 .. 1 70 [] 69.4 8.2e-20
CP001814_0187 1/1 222 287 .. 1 70 [] 69.3 8.7e-20
CP001814_1581 1/1 249 316 .. 1 70 [] 68.6 1.4e-19
CP001814_0211 1/1 180 247 .. 1 70 [] 67.9 2.2e-19
CP001814_2513 1/1 458 525 .. 1 70 [] 67.7 2.5e-19
CP001814_4378 1/1 163 229 .. 1 70 [] 67.1 3.8e-19
CP001814_0086 2/2 519 580 .. 1 64 [. 66.4 5.9e-19
CP001814_2446 1/1 198 262 .. 1 70 [] 65.5 1.1e-18
CP001814_4227 1/1 197 264 .. 1 70 [] 64.7 1.9e-18
CP001814_6229 1/1 474 541 .. 1 70 [] 64.3 2.5e-18
CP001814_0246 1/1 191 253 .. 1 70 [] 62.7 7.6e-18
CP001814_1614 1/1 201 263 .. 1 70 [] 62.3 1e-17
CP001814_1861 1/1 183 243 .. 1 70 [] 60.7 3e-17
CP001814_5830 1/1 169 235 .. 1 70 [] 60.7 3e-17
CP001814_0571 1/1 169 237 .. 1 70 [] 58.9 9.8e-17
CP001814_1379 1/1 476 541 .. 1 70 [] 58.7 1.2e-16
CP001814_4157 1/1 241 308 .. 1 70 [] 58.5 1.3e-16
CP001814_3133 1/1 160 221 .. 1 64 [. 57.9 1.9e-16
CP001814_3207 2/2 460 524 .. 1 70 [] 57.9 1.9e-16
CP001814_3537 2/2 168 233 .. 1 70 [] 57.7 2.3e-16
CP001814_0517 1/1 209 276 .. 1 70 [] 57.4 2.8e-16
CP001814_1835 1/1 198 264 .. 1 70 [] 56.1 6.5e-16
CP001814_2421 1/1 205 270 .. 1 70 [] 55.5 9.9e-16
CP001814_5806 1/1 215 281 .. 1 70 [] 55.0 1.4e-15
CP001814_7296 2/2 398 460 .. 1 70 [] 54.0 2.8e-15
CP001814_3397 1/1 397 462 .. 1 70 [] 53.9 3e-15
CP001814_5865 1/1 226 293 .. 1 70 [] 52.6 6.9e-15
CP001814_7059 3/3 537 595 .. 1 61 [. 52.3 8.7e-15
CP001814_7831 1/1 164 231 .. 1 70 [] 52.2 9.3e-15
CP001814_2511 1/1 526 593 .. 1 70 [] 51.7 1.3e-14
CP001814_4381 1/1 444 510 .. 1 70 [] 49.5 5.9e-14
CP001814_7738 1/1 376 430 .. 1 61 [. 47.2 2.8e-13
CP001814_4595 1/1 372 437 .. 1 70 [] 42.5 6.9e-12
CP001814_2362 1/1 190 256 .. 1 70 [] 42.3 7.8e-12
CP001814_3394 1/1 186 251 .. 1 70 [] 41.9 1e-11
CP001814_8297 1/1 183 244 .. 1 70 [] 36.3 4.5e-10
CP001814_4691 1/1 80 100 .. 1 21 [. 34.6 1.5e-09

Alignments of top-scoring domains:
CP001814_1676: domain 1 of 1, from 175 to 242: score 101.6, E = 2.6e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s+i++q+++a +++ d+dpe+ar a+++i
CP001814_1 175 ERARIARELHDVVAHNVSVIIVQADGAGYAI--DSDPEQARVAMRAI 219

relarealaevRrllgdLRpaal<-*
+e++r+alae+Rr++g+LR+++
CP001814_1 220 AETGRQALAEMRRMVGVLRTDGV 242

CP001814_5577: domain 1 of 1, from 194 to 261: score 100.8, E = 4.6e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++++q+++arr+l +++p+ areal +i
CP001814_5 194 ERSRIARELHDVVAHHVSVMTVQASAARRVL--ATNPDGAREALSAI 238

relarealaevRrllgdLRpaal<-*
+e++r+a+ae+R+++g+LR++a
CP001814_5 239 EEMGRTAMAEMRNIVGVLRTDAA 261

CP001814_8365: domain 1 of 1, from 182 to 249: score 97.1, E = 5.6e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++g+++s+i++q+++a++++ ++ p++a++al++i
CP001814_8 182 ERLRIARELHDTLGHNISMINVQAGAALHRI--KDRPGQAETALATI 226

relarealaevRrllgdLRpaal<-*
+e+++eal+e+R++lg+LR ++
CP001814_8 227 KEASKEALRELRATLGVLRQVDE 249

CP001814_5308: domain 1 of 1, from 205 to 272: score 92.8, E = 1e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++s+s+i+++++ a +++ ++ peear+al+ i
CP001814_5 205 ERLRIARELHDVVAHSMSLIAVKAGIANHVA--EARPEEARDALRVI 249

relarealaevRrllgdLRpaal<-*
++++r al+e+R+llg++R ++
CP001814_5 250 EATSRGALTEMRHLLGVMRSGTA 272

CP001814_5702: domain 1 of 1, from 144 to 208: score 88.9, E = 1.5e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++gQsL+++ l+l +a+ d++p+ +re+l+++
CP001814_5 144 ERQRIARELHDEIGQSLTVVLLGLKRAA-----DRAPDDLREELHTV 185

relarealaevRrllgdLRpaal<-*
+e++r +l+evR+++++LRp++l
CP001814_5 186 QETVRASLDEVRQVARRLRPGVL 208

CP001814_4521: domain 1 of 1, from 167 to 233: score 87.9, E = 2.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+++Q++s+i+ qle+a++ + +dp+ +r+++ +
CP001814_4 167 ERARLAREIHDTLAQGFSGIIAQLEAAQQGI---DDPDTVRKRISLA 210

relarealaevRrllgdLRpaal<-*
++lar++l+e+Rr + +LRp l
CP001814_4 211 KQLARDSLNEARRSVDALRPEPL 233

CP001814_1608: domain 1 of 1, from 237 to 304: score 86.4, E = 7.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD vg+sLsai++++e+a++l + d e+a+ +++e+
CP001814_1 237 ERLRFSRDLHDLVGHSLSAIAVKSEVAAKLS--KVDTERAAGEMEEV 281

relarealaevRrllgdLRpaal<-*
r+lareal+e+R++++++R+ +l
CP001814_1 282 RGLAREALKEIRAAVRGYRTVDL 304

CP001814_3126: domain 1 of 1, from 222 to 289: score 85.5, E = 1.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v++++s+i++q+e++ ++ + d+++++e l+ei
CP001814_3 222 ERARIARELHDVVAHHMSVIAIQAEAVPLQA--AGDAGRLEEGLREI 266

relarealaevRrllgdLRpaal<-*
r+l+ a++e+Rr++g+LR+++
CP001814_3 267 RALSLAAMTEMRRVVGVLRDGDG 289

CP001814_5102: domain 1 of 1, from 212 to 279: score 85.1, E = 1.9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R+ARELHDsvg++Ls++++q+++a r+l d+dpe+ar+al++i
CP001814_5 212 TRNRLARELHDSVGHALSVVTVQAGAAGRVL--DRDPEAARTALTAI 256

relarealaevRrllgdLRpaal<-*
+e ar al+++ ++lg LR+ +
CP001814_5 257 EESARSALEDLDHVLGLLREEES 279

CP001814_3902: domain 1 of 1, from 173 to 240: score 84.9, E = 2.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD +g++Ls++ +++e++rrl+ ++d+e+a+++++ i
CP001814_3 173 ERLRFSRDLHDLLGHTLSVMVVKAEAVRRLA--PRDAEAAARQAADI 217

relarealaevRrllgdLRpaal<-*
++++r+al+evR++++++R +l
CP001814_3 218 ETAGRQALREVRATVTGYRGRGL 240

CP001814_0870: domain 1 of 1, from 182 to 249: score 84.9, E = 2.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L+++ + l++a r+ ++dpe+a ++++++
CP001814_0 182 ERERLAREIHDTLAQGLTSLGILLQAADRMW--AADPERAHAHVRRA 226

relarealaevRrllgdLRpaal<-*
+++a e l+e+Rr ++dL+p++l
CP001814_0 227 ATAAAENLDEARRFVRDLQPSGL 249

CP001814_1455: domain 1 of 1, from 174 to 241: score 84.7, E = 2.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +A+ELHD++++++s+i +q+++a++l+ d+ pe+ar+al++i
CP001814_1 174 ERLTMAQELHDVLAHNISLIHVQASTALHLI--DDQPEQARTALTTI 218

relarealaevRrllgdLRpaal<-*
++++++ l+e+R +l +LR++a
CP001814_1 219 KQASKDVLTEMRSVLNVLRDGAP 241

CP001814_0469: domain 1 of 1, from 178 to 245: score 83.3, E = 6.3e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD v Q L++++l +++a+ l+ ++dp++a e+l+++
CP001814_0 178 ERTRMARELHDAVTQKLFSLRLTTQAAASLV--TRDPARALEELERV 222

relarealaevRrllgdLRpaal<-*
++la ealae+R+++ +LRpa+l
CP001814_0 223 ERLAGEALAELRAVIVELRPAEL 245

CP001814_8371: domain 1 of 1, from 185 to 253: score 82.2, E = 1.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIARE+HD++g++Ls++++++++++++ d+++e +++a++ i
CP001814_8 185 TRERIAREIHDVLGHRLSLLSVHAGALEYHP--DAPAEDVARAAKVI 229

relarealaevRrllgdLR.paal<-*
re a++al+++R+++g+LR p ++
CP001814_8 230 RESAHQALQDLREVIGVLRaPVGE 253

CP001814_5008: domain 1 of 1, from 163 to 230: score 77.1, E = 4.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARELHD++++s s+i +q+ +a ++ d+ p++ar+al+ i
CP001814_5 163 EQARIARELHDVIAHSVSVIVVQAAAADDVF--DERPDQARAALRSI 207

relarealaevRrllgdLRpaal<-*
+ ++real e+Rrll + Rp+a+
CP001814_5 208 ESAGREALGELRRLLAAVRPDAD 230

CP001814_0295: domain 1 of 1, from 186 to 253: score 77.1, E = 4.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD ++++ s + +q+e+ ++ ++dp++a++a+d+i
CP001814_0 186 ERARIARDMHDILAHAVSIMVVQAEAGPVVI--RSDPARAEAAFDAI 230

relarealaevRrllgdLRpaal<-*
++ +r+a+ ++Rr+lg+L++ +
CP001814_0 231 AASGRDAMVQLRRMLGVLKEEEG 253

CP001814_7217: domain 1 of 1, from 177 to 244: score 76.9, E = 4.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v++s s++ +q+++ar +l + d re l +
CP001814_7 177 ERTRIARELHDVVAHSVSVMVMQAGAARLML--RPDQVTERESLNVV 221

relarealaevRrllgdLRpaal<-*
+e++re +e+Rr+lg LR++ +
CP001814_7 222 EETGREVVEELRRMLGLLRTGPE 244

CP001814_8374: domain 1 of 1, from 162 to 229: score 76.9, E = 4.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v++++++i lq+++a+ ++ +k+pe+ + l+ i
CP001814_8 162 ERLELARELHDVVAHHITSIVLQAQAAQLVT--AKHPEKTAGSLADI 206

relarealaevRrllgdLRpaal<-*
+++++eala +Rr++g LR+a+
CP001814_8 207 ETAGSEALAATRRVVGLLRDAVP 229

CP001814_6927: domain 1 of 1, from 210 to 278: score 76.9, E = 4.9e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v ++Ls++ +++a + ++ p++a +a+++i
CP001814_6 210 ERARIAREMHDIVTHNLSVMVALADGAVFAQ--TRSPDRATTAMRQI 254

relarealaevRrllgdLR.paal<-*
+++r+al+++Rr lg+LR ++ +
CP001814_6 255 SGTGRQALTDMRRSLGVLRvDGPD 278

CP001814_0778: domain 1 of 1, from 210 to 276: score 76.7, E = 5.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L++i+ ql++a+ ++ ++ p++ r+ + ++
CP001814_0 210 ERQRMAREIHDTLAQGLTGIIAQLQAAE-QM--HEVPAPWRRPFGAV 253

relarealaevRrllgdLRpaal<-*
+ lare+lae+Rr + +LRp l
CP001814_0 254 KNLARESLAEARRSVDALRPEPL 276

CP001814_2220: domain 1 of 1, from 223 to 290: score 75.9, E = 9.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD+ Q+L ++++ l++ar+ l ++ pe+ar+a+ ++
CP001814_2 223 ERRRLERDLHDGAQQRLVSLAMNLGMARATL--TDVPEPARQAIVRA 267

relarealaevRrllgdLRpaal<-*
+e a++al+e+R+l+++L+pa+l
CP001814_2 268 HEEAKQALKELRDLVRGLHPAVL 290

CP001814_4312: domain 1 of 1, from 178 to 245: score 75.9, E = 1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDs+ +s+s+ik+q+++a +l+ +k e + al +i
CP001814_4 178 ERLRIARELHDSLTHSISVIKVQAGVAVHLA--RKRGEDVPPALLAI 222

relarealaevRrllgdLRpaal<-*
+e++ +a++e+R++l +LR+++
CP001814_4 223 QEASGDAMRELRATLEVLRDSDR 245

CP001814_3959: domain 1 of 1, from 181 to 244: score 74.9, E = 2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v+++L++i q+ + r l+ p++a+e l+++
CP001814_3 181 ERARIAREMHDVVAHALAVIVAQARGGR-LI-----PDRAAEVLATV 221

relarealaevRrllgdLRpaal<-*
+e++r+al+e+R l+g+LR ++
CP001814_3 222 EETGRQALTEMRGLVGVLRSDTA 244

CP001814_4274: domain 1 of 1, from 184 to 250: score 74.8, E = 2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l+ ++p++++++l ++
CP001814_4 184 ERTRIARELHDVVTHHVTAMVVQAEAARYLT---AAPDRLDATLSAV 227

relarealaevRrllgdLRpaal<-*
+++r+a+a++R++l L+ + +
CP001814_4 228 TDTGRRAIADLRHMLDLLKADHD 250

CP001814_3843: domain 1 of 1, from 344 to 409: score 74.4, E = 2.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+ HD v+++ a+ l +++a++++ ++ +++eal i
CP001814_3 344 ERERIARDVHDIVAHHVGAMVLRAGAAQYAA--PSG--PVAEALSDI 386

relarealaevRrllgdLRpaal<-*
r ++++ l+++R ll +LR+++l
CP001814_3 387 RSTGHQVLEDLRGLLNVLRDPDL 409

CP001814_6838: domain 1 of 1, from 183 to 249: score 74.1, E = 3.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+v+++ s++ l++++++ +++e+ +ea++ i
CP001814_6 183 ERARIAREMHDVVAHRVSLMVLHAGALEV----GAPDERTAEAAALI 225

relarealaevRrllgdLR.paal<-*
+ +real+ +R++lg+LR+p+
CP001814_6 226 GGVGREALSNLREVLGVLRsPDPA 249

CP001814_0068: domain 1 of 1, from 204 to 270: score 74.1, E = 3.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+v+Q+L ai q+e+ + ++ d++++r++l+ +
CP001814_0 204 ERGRLAREFHDTVAQGLVAIVTQIEATEEAV---NDADAVRRRLAVV 247

relarealaevRrllgdLRpaal<-*
r lare+laevRr l dLRp+ l
CP001814_0 248 RSLARESLAEVRRSLDDLRPGPL 270

CP001814_4058: domain 1 of 1, from 190 to 257: score 74.1, E = 3.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++ +++++++ d++pe++++a+ +
CP001814_4 190 ERTRIAREMHDVLAHRLSLLATYAGALEYRP--DSPPEQLARAAGVV 234

relarealaevRrllgdLRpaal<-*
r+ a++al+e+R+++ LR+ +
CP001814_4 235 RAGAHQALDELRDVINLLRDEDT 257

CP001814_2584: domain 1 of 1, from 63 to 130: score 73.1, E = 6.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ELHD+v++++s+++l++++ r+++ +kdp +are+l+ +
CP001814_2 63 ERTRIAHELHDVVAHGISMMTLGVGAGRMIM--EKDPVRARETLRLA 107

relarealaevRrllgdLRpaal<-*
+e +r+al e+ r+l LR+ +
CP001814_2 108 EESGRQALLELQRMLCLLRTEGS 130

CP001814_8887: domain 1 of 1, from 214 to 281: score 73.1, E = 6.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ai + l++++ l+ d+dpe+a++ l+ +
CP001814_8 214 ELRRIERDLHDGAQARLVAIGMTLGAVEELM--DRDPEAAKALLAKA 258

relarealaevRrllgdLRpaal<-*
re++++al+e+R l+++++p++l
CP001814_8 259 REASSTALTELRGLVRGIHPPVL 281

CP001814_8145: domain 1 of 1, from 178 to 245: score 72.6, E = 9.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v++++++i +q+++a+ ++ + pe++ l++i
CP001814_8 178 ERLELARELHDLVAHHITGIVVQAQAAKIVA--QQKPEAVVPSLEAI 222

relarealaevRrllgdLRpaal<-*
+ ++ +al+ +Rrl+++LR ++
CP001814_8 223 ANAGADALTSMRRLVSVLRAEDD 245

CP001814_0516: domain 1 of 1, from 497 to 564: score 72.4, E = 1.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ RELHD++g +L++++l l+ arr+l d+dp ++++ l ++
CP001814_0 497 ERRRLGRELHDGLGPALTSVTLTLDEARRRL--DTDPRAVEKLLVRV 541

relarealaevRrllgdLRpaal<-*
re ++a vR+l+ +LRp+al
CP001814_0 542 REEMTATIASVRELVYGLRPPAL 564

CP001814_5879: domain 1 of 1, from 187 to 253: score 72.0, E = 1.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD v+++++ + l++++ar+ + ++pe +r+al ++
CP001814_5 187 ERRRIARELHDIVAHHITTMQLMAGGARANI---AEPEVVRDALVTL 230

relarealaevRrllgdLRpaal<-*
+ +r al+e+R+ll +LR +++
CP001814_5 231 ESSGRLALREMRQLLDVLRAGDE 253

CP001814_4464: domain 1 of 1, from 198 to 265: score 71.7, E = 1.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IA E+HD++++++s++++ ++++ +++ d +e+ re++++i
CP001814_4 198 ERVKIAHEMHDVLAHRISLLAMLAGGLSHRT--DLTAEQTRETAQAI 242

relarealaevRrllgdLRpaal<-*
+e a+++l+e+R++lg+LR ++
CP001814_4 243 QENAHQSLNELRAVLGTLRRDGG 265

CP001814_3082: domain 1 of 1, from 206 to 273: score 69.5, E = 7.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ ++L+a+ +ql+lar + ++dpe+ ++a+ +
CP001814_3 206 ERRRIERDLHDGTQHQLTAVLMQLGLARLDV--REDPERTAKAIGLA 250

relarealaevRrllgdLRpaal<-*
++ + al+e+Rr++++++p+al
CP001814_3 251 YDHTQAALDELRRVIRGIHPSAL 273

CP001814_3896: domain 1 of 1, from 188 to 253: score 69.4, E = 8.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+L a+++ +++arr ++pe ++e l+++
CP001814_3 188 ERRRIERDLHDGVQQRLVALAMLIGRARR----GRAPELLDELLRQA 230

relarealaevRrllgdLRpaal<-*
+e ar al ++R+++++ p++l
CP001814_3 231 HEEARGALGDLREVAWRVYPTGL 253

CP001814_0187: domain 1 of 1, from 222 to 287: score 69.3, E = 8.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER RI+RE+HD+v++sL+++ q+e+ r +dp+++ + +++
CP001814_0 222 ERDRISREMHDVVSHSLAVMVSQAEGGR-----LSDPGsPGAGVFAT 263

irelarealaevRrllgdLRpaal<-*
i++ +real+++R llg+LR ++
CP001814_0 264 IAGVGREALRDMRGLLGVLRADGG 287

CP001814_1581: domain 1 of 1, from 249 to 316: score 68.6, E = 1.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L ++++ l++a++ + d+dp+ are l+++
CP001814_1 249 ERRRIERDLHDGAQQRLLSVAMDLGRAQAKM--DSDPQGARELLAQA 293

relarealaevRrllgdLRpaal<-*
++ a+ a+ae+R+l+++++pa+l
CP001814_1 294 HAGAKAAIAELRDLARGIHPAIL 316

CP001814_0211: domain 1 of 1, from 180 to 247: score 67.9, E = 2.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD ++ ++sai++q+ +++ + d ++e++r ++ i
CP001814_0 180 ERARMARELHDMIANHFSAIAIQSTAVLSRK--DLNAEAVRNVMESI 224

relarealaevRrllgdLRpaal<-*
re + +++ae+R ++g LR +++
CP001814_0 225 RENSVQGMAEMRTMIGLLRQDGE 247

CP001814_2513: domain 1 of 1, from 458 to 525: score 67.7, E = 2.5e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++gQsLs++++ + +arr l + pe a+ l+e+
CP001814_2 458 ERRRLRRDLHDGLGQSLSGMAMSINAARRSL--HVSPETADLMLTEL 502

relarealaevRrllgdLRpaal<-*
r + +++R+l+ +LRp+al
CP001814_2 503 RSGMDSVTSDIRHLVYGLRPPAL 525

CP001814_4378: domain 1 of 1, from 163 to 229: score 67.1, E = 3.8e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER IARELHD+v+++ +++++q++ ar +++p++++ e +++
CP001814_4 163 ERLTIARELHDVVAHGVTLMTVQAGIARL----RSAPDdPLHEVVET 205

irelarealaevRrllgdLRpaal<-*
i++++r +lae+Rrl LR ++
CP001814_4 206 IEQTGRSSLAEMRRLMNLLRSDDA 229

CP001814_0086: domain 2 of 2, from 519 to 580: score 66.4, E = 5.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g++L+ai l++el+rrll d+dpe+ar++l i
CP001814_0 519 ERLRVARDLHDLLGHNLAAILLKSELVRRLL--DRDPERARAELGDI 563

relarealaevRrllgd<-*
++++a a++R++ gd
CP001814_0 564 VVISERARADMRAVSGD 580

CP001814_2446: domain 1 of 1, from 198 to 262: score 65.5, E = 1.1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++s s++ +q++++rr e l i
CP001814_2 198 ERVRIARELHDVVAHSVSMMVMQAGVLRRTQ--V----GENEVLLGI 238

relarealaevRrllgdLR.paal<-*
++++rea +e+R +lg+LR p ++
CP001814_2 239 ERMGREAVEELRVMLGALRmPLDE 262

CP001814_4227: domain 1 of 1, from 197 to 264: score 64.7, E = 1.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L i++ql++ar l ++dp+++++ l+++
CP001814_4 197 ELQRIERDLHDGTQARLVTIAMQLGMARESL--ADDPDAVAALLAQA 241

relarealaevRrllgdLRpaal<-*
+e+a+ea+ e+R +l+++ p++l
CP001814_4 242 HETAEEAMVELRTVLQTIYPPIL 264

CP001814_6229: domain 1 of 1, from 474 to 541: score 64.3, E = 2.5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++gQ+Ls++++ + +ar l ++ pe+a+ l+e+
CP001814_6 474 ERRRLRRDLHDGLGQTLSGMAMAVNMARLSL--KTSPEAADGLLREL 518

relarealaevRrllgdLRpaal<-*
r + ++R+l+ +LRp++l
CP001814_6 519 RSGMDAVTGDIRQLVYGLRPPVL 541

CP001814_0246: domain 1 of 1, from 191 to 253: score 62.7, E = 7.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q+L++i+ ql++a+ +++ r+++d++
CP001814_0 191 ERQRMAAEIHDTLAQGLTGIITQLQAAQ-----QAE--DWRRHMDNA 230

relarealaevRrllgdLRpaal<-*
+lare+lae+Rr +++ p++l
CP001814_0 231 VRLARESLAEARRSVHAVGPGQL 253

CP001814_1614: domain 1 of 1, from 201 to 263: score 62.3, E = 1e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+++Q++++i++ +++a+++ +++l +
CP001814_1 201 ERERLAGEIHDTLAQGFTSIIMLIQAAEAQS-------DPARHLSLA 240

relarealaevRrllgdLRpaal<-*
++are lae+R+l+ +L pa l
CP001814_1 241 VQTARENLAEARALIAALSPAPL 263

CP001814_1861: domain 1 of 1, from 183 to 243: score 60.7, E = 3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+Ls+i l l +a + dp +e+
CP001814_1 183 ERQRLAREIHDTLAQGLSSIVLLLRAA------PPDPSGYV---EEA 220

relarealaevRrllgdLRpaal<-*
r++a++ lae+Rr +++L p++l
CP001814_1 221 RHAAEDNLAEARRFVHALTPPGL 243

CP001814_5830: domain 1 of 1, from 169 to 235: score 60.7, E = 3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+A E+HD+v ++ s++ l ++++r+++ +++ +rea++e+
CP001814_5 169 ERARLAGEMHDVVTHRVSLMVLRAGALRTIA--RDE--VVREAAEEL 211

relarealaevRrllgdLR.paal<-*
r+ + +al+e+R+l+g+LR++ ++
CP001814_5 212 RQVGCQALEELRDLVGVLRsEETF 235

CP001814_0571: domain 1 of 1, from 169 to 237: score 58.9, E = 9.8e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +AR+LHD+v+++ sa+++ +++ ++ ++ p +a +al+ i
CP001814_0 169 EREQLARDLHDTVAHHVSAMAIRAQAGLATS--ESRPNAATDALRVI 213

relarealaevRrllgdLR.paal<-*
+ a +al+e+R++++ LR+++
CP001814_0 214 EVEAARALDEMRAMVRILRrDQPA 237

CP001814_1379: domain 1 of 1, from 476 to 541: score 58.7, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L+a+++ +e+++ l+ +++ ar+ l+ i
CP001814_1 476 ERRRLRRDLHDGLGPTLAALTMRAEAVHDLV--EEE--HARRLLADI 518

relarealaevRrllgdLRpaal<-*
+ a+ a ++vR l+ +LRp+al
CP001814_1 519 VGDAEAAVTDVRTLVDGLRPPAL 541

CP001814_4157: domain 1 of 1, from 241 to 308: score 58.5, E = 1.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L +i+l++ela+rl+ ++dp +a+++++e+
CP001814_4 241 ERLRFAADLHDIQGHHLQVIALKSELAERLA--EADPVRAAAEMREV 285

relarealaevRrllgdLRpaal<-*
r+la +al+++R++++++R ++l
CP001814_4 286 RRLAADALRDTRAVVQGYRRTTL 308

CP001814_3133: domain 1 of 1, from 160 to 221: score 57.9, E = 1.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ R++HD v ++Ls++ ++ a+++ + +pe+a++a+++i
CP001814_3 160 ERARMTRDMHDIVTHNLSVMVALADSAAYVR--HGAPEQAAAAVEQI 204

relarealaevRrllgd<-*
++++r+al+++Rr lg+
CP001814_3 205 AATGRQALDDMRRSLGA 221

CP001814_3207: domain 2 of 2, from 460 to 524: score 57.9, E = 1.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L+ i + l+l+r + +p+ +r++l+e+
CP001814_3 460 ERRRLRRDLHDGLGPGLATICVRLDLIR-----AMAPAGLRDQLREV 501

relarealaevRrllgdLRpaal<-*
r+l + ++Rr+++dLRp+al
CP001814_3 502 RQLTDGLVGDIRRTVHDLRPPAL 524

CP001814_3537: domain 2 of 2, from 168 to 233: score 57.7, E = 2.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+v+++ s++ l +++++ + ++ + +++++ i
CP001814_3 168 ERARIARDMHDVVAHRVSLMVLRAGALEINA--VDE--KTAAEAELI 210

relarealaevRrllgdLRpaal<-*
r +++eal+++R++lg L +
CP001814_3 211 RVTGKEALEQLRAVLGILTEVPR 233

CP001814_0517: domain 1 of 1, from 209 to 276: score 57.4, E = 2.8e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L+++++ ++ ar +l ++dpe+++ l ++
CP001814_0 209 ERRRLRRDLHDGLGPTLASLAMTVDEARLRL--ERDPEAVEGLLIRV 253

relarealaevRrllgdLRpaal<-*
r+ +a+ +vR+l+ +LRp+al
CP001814_0 254 RDQMGTAIIDVRDLVYGLRPPAL 276

CP001814_1835: domain 1 of 1, from 198 to 264: score 56.1, E = 6.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+++HDs+g+ L++i+l + +++ ++ ++ +e+ r+a+ e+
CP001814_1 198 ERNRIAQDMHDSLGHDLALIALRAAALE-MA--PDLAERHRKAAGEL 241

relarealaevRrllgdLRpaal<-*
re+a + + +Rr++g+LR+++
CP001814_1 242 REAAAGTTERLRRVIGVLREDDR 264

CP001814_2421: domain 1 of 1, from 205 to 270: score 55.5, E = 9.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L ++++ l+lar dp+++re ++e+
CP001814_2 205 ELRRIERDLHDGAQARLVSVRMNLGLARS----SHDPAQVRELIEEA 247

relarealaevRrllgdLRpaal<-*
e +al ++R+l+++++p++l
CP001814_2 248 WESTGQALGDLRDLVRGIHPPVL 270

CP001814_5806: domain 1 of 1, from 215 to 281: score 55.0, E = 1.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+RI R+LHD+ Q+L a++l+l++a+ d +p+++a+e+++e
CP001814_5 215 ERRRIERDLHDGAQQRLVALTLKLGMAQL----DLEPGsPAAERVAE 257

irelarealaevRrllgdLRpaal<-*
++e a +alae+R+l+++ +p +l
CP001814_5 258 AHEEAMRALAELRELIRGVHPRIL 281

CP001814_7296: domain 2 of 2, from 398 to 460: score 54.0, E = 2.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R +HD+v Q+L a++ +lelar+ e l+ +
CP001814_7 398 ERRRIERNIHDGVQQQLVALIAGLELARATG-------GGPEGLALL 437

relarealaevRrllgdLRpaal<-*
re ar++l+++R+l+ +++p++l
CP001814_7 438 REQARQTLTDLRELAAGIHPSVL 460

CP001814_3397: domain 1 of 1, from 397 to 462: score 53.9, E = 3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v Q+L+a+++ l rl+ d++ ea +l++
CP001814_3 397 ERDRIARDLHDVVIQRLFAVAMTLMSTVRLV--DRP--EASGRLQNS 439

relarealaevRrllgdLRpaal<-*
+ ++ +++++R ++ +L++++
CP001814_3 440 IDELDGTIRQIRSTIFALQTSQR 462

CP001814_5865: domain 1 of 1, from 226 to 293: score 52.6, E = 6.9e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
+R+ R++HD+ Q+L ++++ l++a+r+l ++dp+++++ l ++
CP001814_5 226 ALRRLERDIHDGPQQRLVSLAMDLSRAQRQL--KRDPQAVEAMLSQA 270

relarealaevRrllgdLRpaal<-*
+ r++l+e+R+l +++ p++l
CP001814_5 271 ITSTRDTLDELRALSRGIAPPIL 293

CP001814_7059: domain 3 of 3, from 537 to 595: score 52.3, E = 8.7e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD +g +Lsa+ ++ ela rl+ +p++ar +l+e+
CP001814_7 537 ERLRIARDLHDLLGFQLSAVVVKGELADRLA--GGAPGAARVHLTEA 581

relarealaevRrl<-*
+la++al+ vR +
CP001814_7 582 VALAEQALSSVRSV 595

CP001814_7831: domain 1 of 1, from 164 to 231: score 52.2, E = 9.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R I+RE HD v+++L+++ ++l +a+ +l ++ pee real+++
CP001814_7 164 QRLEISREVHDIVAHTLAVVGVHLNVAADAL--EESPEETREALRTA 208

relarealaevRrllgdLRpaal<-*
++ +a+a++R l+g+LR +++
CP001814_7 209 MDVRGKAMADLRSLIGVLRIDGD 231

CP001814_2511: domain 1 of 1, from 526 to 593: score 51.7, E = 1.3e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g++L+ +++ + +ar + ++ p+ a++ l e+
CP001814_2 526 ERRRLRRDLHDGLGHALTDMAMSINMARISM--RTSPASADRLLSEL 570

relarealaevRrllgdLRpaal<-*
r + +e+R+l+ +LRp++l
CP001814_2 571 RSGMDAVGQEIRELVYGLRPPTL 593

CP001814_4381: domain 1 of 1, from 444 to 510: score 49.5, E = 5.9e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD++g +L++i+++le++rr l p+ a + l +
CP001814_4 444 ERRRLHRDLHDGLGGRLAGITIGLEAVRRSL---GSPDLAYRLLSDL 487

relarealaevRrllgdLRpaal<-*
r ++ e+R+l+++LRp al
CP001814_4 488 RVGMDDVNGEMRELVQGLRPRAL 510

CP001814_7738: domain 1 of 1, from 376 to 430: score 47.2, E = 2.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI+R+ HD +g sLsai ++ ela ++pe+a+++l+ i
CP001814_7 376 ERRRISRDVHDLLGSSLSAIVVKGELA------VRAPERAERELADI 416

relarealaevRrl<-*
+++ar+ala++R++
CP001814_7 417 ARIARRALADLRAI 430

CP001814_4595: domain 1 of 1, from 372 to 437: score 42.5, E = 6.9e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIA +LHD+v Q+L+a+++ l rl+ d++ ea ++l++
CP001814_4 372 DRDRIAKDLHDVVIQRLFAVAMTLMSTVRLV--DRP--EASARLQTS 414

relarealaevRrllgdLRpaal<-*
+ ++ +++++R ++ +L+ + +
CP001814_4 415 IDELDATIRQIRSTIFALQISSE 437

CP001814_2362: domain 1 of 1, from 190 to 256: score 42.3, E = 7.8e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA ++HD +g+ Ls+i+l +++++ ++ + +++ r+a+ e+
CP001814_2 190 ERARIAGDMHDLLGHELSLIALRIGGLE-VA--PGLDARYRDAAGEA 233

relarealaevRrllgdLRpaal<-*
r+++ a + + +++ +LR++ l
CP001814_2 234 RRAVTVASERLQEIIEVLRDDSL 256

CP001814_3394: domain 1 of 1, from 186 to 251: score 41.9, E = 1e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa I R+LHD+++++ +++ +e+a+ + +++ + r +l i
CP001814_3 186 ERASIRRDLHDVIAHTVTVMVARIEAAAVTT--ADP--ATRLELGDI 228

relarealaevRrllgdLRpaal<-*
+e++r+a + +R++l +L pa+
CP001814_3 229 AEAGRDAHQGLRAMLATLSPATV 251

CP001814_8297: domain 1 of 1, from 183 to 244: score 36.3, E = 4.5e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+v Q+ a+++ l+++r+ + d +a +de+
CP001814_8 183 ERRRIERDLHDGVQQRGVALAMLLGRVRHTA--D----PAL--IDEA 221

relarealaevRrllgdLRpaal<-*
+ +r l+e+R ++++ p+al
CP001814_8 222 YAESRLLLEELRSVAWQVYPTAL 244

CP001814_4691: domain 1 of 1, from 80 to 100: score 34.6, E = 1.5e-09
*->ERaRIARELHDsvgQsLsaik<-*
ER+R+ARE+HD+++Q+L++i+
CP001814_4 80 ERQRMAREIHDTLAQGLTGII 100


Histogram of all scores:
score obs exp (one = represents 23 sequences)
----- --- ---
-14 12 0|=
-13 73 1|*===
-12 124 99|====*=
-11 262 819|============ *
-10 754 1902|================================= *
-9 1298 2160|========================================================= *
-8 1260 1664|======================================================= *
-7 1301 1046|=============================================*===========
-6 1138 592|=========================*========================
-5 1018 317|=============*===============================
-4 576 165|=======*==================
-3 388 85|===*=============
-2 265 43|=*==========
-1 159 22|*======
0 96 11|*====
1 60 5|*==
2 31 2|*=
3 26 1|*=
4 7 0|=
5 6 0|=
6 6 0|=
7 5 0|=
8 3 0|=
9 0 0|
10 0 0|
11 1 0|=
> 12 76 -|====


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 8835.5713
P(chi-square) = 0

Total sequences searched: 8945

Whole sequence top hits:
tophits_s report:
Total hits: 72
Satisfying E cutoff: 72
Total memory: 23K

Domain top hits:
tophits_s report:
Total hits: 72
Satisfying E cutoff: 72
Total memory: 46K


Acknowledgements:

This research is funded by:

Developed by: