Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Sanguibacter keddieii DSM 10542  

Data for CP001819  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001819.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001819_0822 CDS_966264-965002 88.8 6.6e-26 1
CP001819_3601 CDS_4129281-4127956 87.4 1.7e-25 1
CP001819_0341 CDS_390306-391760 76.4 2.8e-22 1
CP001819_0373 CDS_429461-430717 75.1 7e-22 1
CP001819_2102 CDS_2409384-2408113 74.8 8.3e-22 1
CP001819_1921 CDS_2198024-2196804 69.8 2.6e-20 1
CP001819_2486 CDS_2845502-2846878 69.7 2.7e-20 1
CP001819_3495 CDS_4014122-4015486 69.2 3.8e-20 1
CP001819_2915 CDS_3322206-3323561 67.5 1.2e-19 1
CP001819_3216 CDS_3675367-3674132 67.4 1.3e-19 1
CP001819_1099 CDS_1311832-1310657 66.7 2.1e-19 1
CP001819_3691 CDS_4233135-4231864 62.9 2.8e-18 1
CP001819_2614 CDS_2999906-3001198 61.6 6.4e-18 2
CP001819_1636 CDS_1885748-1884321 54.2 9.9e-16 1
CP001819_1647 CDS_1895685-1896941 52.7 2.9e-15 1
CP001819_0642 CDS_755743-754529 46.5 1.8e-13 1
CP001819_0893 CDS_1054179-1055657 36.5 1.7e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001819_0822 1/1 204 272 .. 1 70 [] 88.8 6.6e-26
CP001819_3601 1/1 190 258 .. 1 70 [] 87.4 1.7e-25
CP001819_0341 1/1 253 320 .. 1 70 [] 76.4 2.8e-22
CP001819_0373 1/1 208 275 .. 1 70 [] 75.1 7e-22
CP001819_2102 1/1 200 267 .. 1 70 [] 74.8 8.3e-22
CP001819_1921 1/1 189 256 .. 1 70 [] 69.8 2.6e-20
CP001819_2486 1/1 251 318 .. 1 70 [] 69.7 2.7e-20
CP001819_3495 1/1 261 328 .. 1 70 [] 69.2 3.8e-20
CP001819_2915 1/1 229 297 .. 1 70 [] 67.5 1.2e-19
CP001819_3216 1/1 188 255 .. 1 70 [] 67.4 1.3e-19
CP001819_1099 1/1 172 242 .. 1 70 [] 66.7 2.1e-19
CP001819_3691 1/1 204 271 .. 1 70 [] 62.9 2.8e-18
CP001819_2614 2/2 212 289 .. 1 70 [] 61.5 6.9e-18
CP001819_1636 1/1 236 293 .. 3 62 .. 54.2 9.9e-16
CP001819_1647 1/1 212 276 .. 1 70 [] 52.7 2.9e-15
CP001819_0642 1/1 208 276 .. 1 70 [] 46.5 1.8e-13
CP001819_0893 1/1 291 360 .. 1 70 [] 36.5 1.7e-10

Alignments of top-scoring domains:
CP001819_0822: domain 1 of 1, from 204 to 272: score 88.8, E = 6.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD v++sLs+++ q+++ r+++ dpe+a ++l +i
CP001819_0 204 ERSRIAREMHDIVAHSLSVMIAQADGGRYAA--SHDPEAASRTLGTI 248

relarealaevRrllgdLR.paal<-*
e++r ala++Rrllg+LR+++++
CP001819_0 249 SETGRAALADMRRLLGVLRdDPDD 272

CP001819_3601: domain 1 of 1, from 190 to 258: score 87.4, E = 1.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+++++L++++ q+++a++ll ++ pe+a+eal+ i
CP001819_3 190 ERLRIARELHDVLAHNLTLVNAQAGVAEYLL--ASRPEAAAEALRGI 234

relarealaevRrllgdLR.paal<-*
++ ++a++e+R+++g LR ++++
CP001819_3 235 TQHTSRAIDELRATIGLLRyDGVD 258

CP001819_0341: domain 1 of 1, from 253 to 320: score 76.4, E = 2.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++s s+++ +++a ++l d++p++ real e+
CP001819_0 253 ERARIAREMHDIVAHSVSVMIALSDGASAAL--DRAPDRSREALGEL 297

relarealaevRrllgdLRpaal<-*
+++r+al+++ r+lg+L p+++
CP001819_0 298 SATGRTALTDMQRVLGALDPDGE 320

CP001819_0373: domain 1 of 1, from 208 to 275: score 75.1, E = 7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R +R+LHD+vg +Ls++++++ela+ l+ ++ + a+e++ e+
CP001819_0 208 ERLRFSRDLHDVVGRTLSVVAVKSELAAELA--RRGLDGAAEQMLEV 252

relarealaevRrllgdLRpaal<-*
r++a+e+l+evR l+ ++R+a+l
CP001819_0 253 RQIAQESLREVRTLAVGYRTADL 275

CP001819_2102: domain 1 of 1, from 200 to 267: score 74.8, E = 8.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD ++++s+i++++ +++r++ d+dpe+a++ ++++
CP001819_2 200 ERTAMARELHDIAAHHMSGIAIMSAAIARQI--DTDPEAAKRSVQQV 244

relarealaevRrllgdLRpaal<-*
re + l+++Rrl+g LR+++
CP001819_2 245 REQSTAVLDDLRRLVGLLRHDDG 267

CP001819_1921: domain 1 of 1, from 189 to 256: score 69.8, E = 2.6e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIA++LHD v+++ ++i+l++++a++ l ++ p+ ++ l +i
CP001819_1 189 ERLRIAQDLHDAVAHTVAVIALHAGAAEQNL--RTSPDDSAASLGAI 233

relarealaevRrllgdLRpaal<-*
r +ar+ e+ ++++ LR+ ++
CP001819_1 234 RSAARTVVGEMQQIVQLLRDEGE 256

CP001819_2486: domain 1 of 1, from 251 to 318: score 69.7, E = 2.7e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER IARE HD+++++Ls+++lq+++++ ++ + dp e +ea+ ++
CP001819_2 251 ERDLIAREVHDTLAHRLSLVSLQAGALEVVA--AGDP-EMEEAASAV 294

relarealaevRrllgdLR.paal<-*
++ a+++l+++R l+g+LR+p+
CP001819_2 295 QANAHRSLEDLRGLIGVLRdPGSA 318

CP001819_3495: domain 1 of 1, from 261 to 328: score 69.2, E = 3.8e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RI R+LHD+ Q+L a+ + l++arr++ ++dp++a++ald +
CP001819_3 261 DRRRIERDLHDGAQQRLVALGVELGTARRAA--ATDPDAAAAALDHA 305

relarealaevRrllgdLRpaal<-*
++ ++e+lae+R+l+++++pa+l
CP001819_3 306 HREIKETLAELRDLVRGIHPAVL 328

CP001819_2915: domain 1 of 1, from 229 to 297: score 67.5, E = 1.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ARE+HD+++Q++++i + +++a + ++ + d+e+++++l+ i
CP001819_2 229 ERERVAREIHDTLAQGFTSIVMLAQTASAEAQ-RGDDEQVARRLELI 274

relarealaevRrllgdLRpaal<-*
+++are lae+R l+++ pa l
CP001819_2 275 ERTARENLAEARSLVSASSPAPL 297

CP001819_3216: domain 1 of 1, from 188 to 255: score 67.4, E = 1.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHDs g+ +ai+++++ a++ + + +pe a+ea+ ++
CP001819_3 188 ERVRIARDLHDSAGHLVTAINIHASIAQKTI--HQAPETAAEAISTV 232

relarealaevRrllgdLRpaal<-*
+e +r+a e+ +l++L aa
CP001819_3 233 EEYSRQAVHEIQSVLRVLDGAAA 255

CP001819_1099: domain 1 of 1, from 172 to 242: score 66.7, E = 2.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIAR+LHD Q+L+a +qle++rr++ ++ ++ + ld
CP001819_1 172 ERERIARDLHDLAIQQLFATGMQLETVRRRA--ARGLDkaGLISILD 216

eirelarealaevRrllgdLR.paal<-*
e+ + ++ + +e+R++++ LR+p+a
CP001819_1 217 EALDNVDNSVREIRAIVHSLRdPDAA 242

CP001819_3691: domain 1 of 1, from 204 to 271: score 62.9, E = 2.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD+v++++s+i+l +++a l + pe+areal++i
CP001819_3 204 ERVRIARDLHDVVAHQISVISLSAGVASSSL--ENRPERAREALTTI 248

relarealaevRrllgdLRpaal<-*
r +ar+ l ++ l LR ++
CP001819_3 249 RSAARTVLVDIGSLMALLRSDDA 271

CP001819_2614: domain 2 of 2, from 212 to 289: score 61.5, E = 6.9e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER IARE+HD++++++s+++++++++++++ + + ++ + +
CP001819_2 212 ERSSIAREMHDVLAHRISLLSVHAGALEYRT--RQAESgdaaaltas 256

earealdeirelarealaevRrllgdLR.paal<-*
e+ +a++ ire a++al+e+R++l++LR+++++
CP001819_2 257 EVHDAVAVIRENAHQALEELREVLTVLRsDGTD 289

CP001819_1636: domain 1 of 1, from 236 to 293: score 54.2, E = 9.9e-16
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
aR+AR+ HD+vg+sL+++ q+e a++l d+dp+++r+a++ i++
CP001819_1 236 ARLARDVHDVVGHSLAVVLAQAESAQYLP--DDDPAALRRAMASIAT 280

larealaevRrll<-*
ar++l +vR++l
CP001819_1 281 SARTSLVDVRQVL 293

CP001819_1647: domain 1 of 1, from 212 to 276: score 52.7, E = 2.9e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +AR+LHD+v+ + sa+++ +++a+ + ++++ re+l+++
CP001819_1 212 ERRTMARDLHDVVAGHVSAVAIRTGAAL-----AGPAGRERETLEMA 253

relarealaevRrllgdLRpaal<-*
r+ + al+e+R+++ LR ++
CP001819_1 254 RTSSLAALEEMRAMILLLRADDP 276

CP001819_0642: domain 1 of 1, from 208 to 276: score 46.5, E = 1.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD g++L +i+l+ ela+r+l + p+ a+++l+ i
CP001819_0 208 ERLRFATDLHDIQGHHLQVIALKGELAERRLL-AGQPGLAATELADI 253

relarealaevRrllgdLRpaal<-*
r++a++al+++R+++ d+R+ +
CP001819_0 254 RAIAQTALDDTRAVVNDYRTVTV 276

CP001819_0893: domain 1 of 1, from 291 to 360: score 36.5, E = 1.7e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
+RI R+LHD+ +L ai++ql+ a+ ++ ++ +++e+ + ++
CP001819_0 291 TLRRIERDLHDGTQARLVAIAMQLGEAKEQA--VTAGAsrELTDLIA 335

eirelarealaevRrllgdLRpaal<-*
++++ +e+l e+R+l ++++p+al
CP001819_0 336 AAHTSTKETLVELRELSRGIHPPAL 360


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 3 0|=
-13 33 0|====
-12 50 41|====*
-11 92 340|========== *
-10 355 788|==================================== *
-9 554 895|======================================================== *
-8 536 690|====================================================== *
-7 557 434|===========================================*============
-6 454 245|========================*=====================
-5 419 131|=============*============================
-4 245 68|======*==================
-3 148 35|===*===========
-2 103 18|=*=========
-1 58 9|*=====
0 29 4|*==
1 24 2|*==
2 15 1|*=
3 7 0|=
4 5 0|=
> 5 23 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2891.3328
P(chi-square) = 0

Total sequences searched: 3710

Whole sequence top hits:
tophits_s report:
Total hits: 17
Satisfying E cutoff: 17
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 17
Satisfying E cutoff: 17
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: