Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Xylanimonas cellulosilytica DSM 15894  

Data for CP001821  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001821.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001821_1616 CDS_1773423-1772269 90.7 1.6e-26 1
CP001821_2573 CDS_2857953-2859422 87.8 1.2e-25 1
CP001821_0758 CDS_826193-824808 83.0 2.8e-24 1
CP001821_0238 CDS_285678-284566 77.7 1.1e-22 1
CP001821_1603 CDS_1757358-1756216 76.3 2.7e-22 1
CP001821_0209 CDS_252142-253533 74.8 7.8e-22 1
CP001821_0605 CDS_667276-666035 65.8 3.6e-19 1
CP001821_2689 CDS_3011054-3012337 64.8 6.6e-19 1
CP001821_1600 CDS_1753727-1754902 57.3 1.1e-16 1
CP001821_3284 CDS_3686050-3688140 54.8 6.2e-16 1
CP001821_2499 CDS_2756533-2755229 54.1 9.7e-16 1
CP001821_0189 CDS_231676-230042 51.2 7.1e-15 1
CP001821_0095 CDS_103548-104675 46.4 1.8e-13 1
CP001821_3137 CDS_3520056-3521348 44.8 5.2e-13 1
CP001821_0077 CDS_84506-86272 36.3 1.7e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001821_1616 1/1 184 252 .. 1 70 [] 90.7 1.6e-26
CP001821_2573 1/1 201 268 .. 1 70 [] 87.8 1.2e-25
CP001821_0758 1/1 235 302 .. 1 70 [] 83.0 2.8e-24
CP001821_0238 1/1 180 248 .. 1 70 [] 77.7 1.1e-22
CP001821_1603 1/1 184 250 .. 1 70 [] 76.3 2.7e-22
CP001821_0209 1/1 267 334 .. 1 70 [] 74.8 7.8e-22
CP001821_0605 1/1 213 281 .. 1 70 [] 65.8 3.6e-19
CP001821_2689 1/1 206 273 .. 1 70 [] 64.8 6.6e-19
CP001821_1600 1/1 179 246 .. 1 70 [] 57.3 1.1e-16
CP001821_3284 1/1 486 550 .. 1 70 [] 54.8 6.2e-16
CP001821_2499 1/1 236 301 .. 3 70 .] 54.1 9.7e-16
CP001821_0189 1/1 343 411 .. 1 70 [] 51.2 7.1e-15
CP001821_0095 1/1 159 227 .. 1 70 [] 46.4 1.8e-13
CP001821_3137 1/1 217 285 .. 1 70 [] 44.8 5.2e-13
CP001821_0077 1/1 193 247 .. 1 70 [] 36.3 1.7e-10

Alignments of top-scoring domains:
CP001821_1616: domain 1 of 1, from 184 to 252: score 90.7, E = 1.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD++++s s++ +q+++a+ ++ ++dp+ ar+al+ i
CP001821_1 184 ERARIARELHDVLAHSVSMMVVQAGAAAEVV--EDDPAFARRALESI 228

relarealaevRrllgdLR.paal<-*
r+++ e+l+evRr+++ LR p++
CP001821_1 229 RATGTESLDEVRRVVSILRaPDDA 252

CP001821_2573: domain 1 of 1, from 201 to 268: score 87.8, E = 1.2e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++sLs++ q+++ r+++ ++dp++a++ l+ i
CP001821_2 201 ERARIAREMHDIVAHSLSVVVAQADGGRYAA--AADPAAAARSLEVI 245

relarealaevRrllgdLRpaal<-*
+e++r ala++Rrllg+LR ++
CP001821_2 246 AETGRAALADMRRLLGVLRSDDG 268

CP001821_0758: domain 1 of 1, from 235 to 302: score 83.0, E = 2.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s+++++++++++++ d p+++re+++ i
CP001821_0 235 ERERIAREMHDVLAHRMSLVAMHAGALAYRI--DLSPDQVRETATII 279

relarealaevRrllgdLRpaal<-*
r+ ++al+e+R +lg+LR a+
CP001821_0 280 RDGTHQALEELRGVLGVLRSADT 302

CP001821_0238: domain 1 of 1, from 180 to 248: score 77.7, E = 1.1e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD+v+++ s++ +q+e+ar ++ + pe+a+ al++i
CP001821_0 180 ERERLARDLHDVVSHGVSLMVVQAEAAREVI--GARPEAAANALETI 224

relarealaevRrllgdLR.paal<-*
++++r a++++ r+lg+LR+++++
CP001821_0 225 ADTGRAAMEDLHRMLGVLRdESTD 248

CP001821_1603: domain 1 of 1, from 184 to 250: score 76.3, E = 2.7e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+++ +dp++++ +l+++
CP001821_1 184 ERTRIARELHDVVTHHVTAMVVQAEAARYRI---SDPAALDGTLAAV 227

relarealaevRrllgdLRpaal<-*
++++r+a a++R+ll +L p+
CP001821_1 228 ADTGRRAVADLRDLLDVLDPGHG 250

CP001821_0209: domain 1 of 1, from 267 to 334: score 74.8, E = 7.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+ + l++a+r++ ++dp++a++ald +
CP001821_0 267 ERRRIERDLHDGAQQRLVALGVELGVAKRQA--ERDPAAAAAALDHA 311

relarealaevRrllgdLRpaal<-*
++ ++e+lae+R+l+++++pa+l
CP001821_0 312 HTEIKETLAELRDLVRGIHPAVL 334

CP001821_0605: domain 1 of 1, from 213 to 281: score 65.8, E = 3.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++ ++ q+++a +ld + d+++are+l+ +
CP001821_0 213 ERERLAREIHDTLAQGFMSVVTQVQVASSALD-RGDDAAARERLAIV 258

relarealaevRrllgdLRpaal<-*
+++ar+ lae+R l+ ++ p l
CP001821_0 259 EATARDNLAEARGLVAAFAPVSL 281

CP001821_2689: domain 1 of 1, from 206 to 273: score 64.8, E = 6.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER ++RELHD ++++s+i+l ++++ r++ d dpe+a+ ++++
CP001821_2 206 ERVAMSRELHDIAAHHMSGIALLASAIYRQV--DLDPEAAKVSAQQV 250

relarealaevRrllgdLRpaal<-*
r+ + + l+++Rr++g LR+ a+
CP001821_2 251 RAQSTTVLDDLRRVIGLLRDEAE 273

CP001821_1600: domain 1 of 1, from 179 to 246: score 57.3, E = 1.1e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R IAR+LHD+v++++++i+l++++a +++ ++ p+ a++al +i
CP001821_1 179 TRLSIARDLHDVVAHQIAVINLHAGAASAAV--RTRPDDAEAALGTI 223

relarealaevRrllgdLRpaal<-*
r+ +r l+e+ +l +LR+++
CP001821_1 224 RQSSRAVLSEIGDLMATLRDPDA 246

CP001821_3284: domain 1 of 1, from 486 to 550: score 54.8, E = 6.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R R LHD+vg +L ++++ql+++r d+ ++e +ea++++
CP001821_3 486 ERRRVQRALHDGVGPTLVGVAMQLDAVR-----DRVDPESAEAVARA 527

relarealaevRrllgdLRpaal<-*
++r+a++ +Rr++ +LRp++l
CP001821_3 528 GVHLRDAIDGLRRAIDGLRPPEL 550

CP001821_2499: domain 1 of 1, from 236 to 301: score 54.1, E = 9.7e-16
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+RI R+LHD+ +L a+++ql+ ar +l ++dp+ a+e l+++++
CP001821_2 236 RRIERDLHDGTQARLVAVAMQLGDAREQL--ATDPALAAELLETAHA 280

larealaevRrllgdLRpaal<-*
+eal+e+R+++++++p+al
CP001821_2 281 STKEALTELREIARGIHPPAL 301

CP001821_0189: domain 1 of 1, from 343 to 411: score 51.2, E = 7.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+RIAR+LHD Q+L+a l+l++++r+l+ ++d++ ++++ ++
CP001821_0 343 DRHRIARDLHDLAIQRLFATGLGLQGVARRLE-RADDADDAARVWAA 388

relarealaevRrllgdLRpaal<-*
+ ++e++ +R ++++L+p+++
CP001821_0 389 VDEVDETIGLIRTTIRGLQPSGD 411

CP001821_0095: domain 1 of 1, from 159 to 227: score 46.4, E = 1.8e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R AR+ HD+vg++L +++ ++++r l d+d e+re l+ i
CP001821_0 159 VRLEVARDVHDVVGHALGLVSAEAGVVRSLP--DADERELRESLADI 203

relarealaevRrllgdLR.paal<-*
+ +ar+al+e+ l+++LR+ ++l
CP001821_0 204 EVHARRALEEMQSLVRGLRgLPGL 227

CP001821_3137: domain 1 of 1, from 217 to 285: score 44.8, E = 5.2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR A+ELHD+ +Q+L+++ +++a l d+dp+ a + ++e+
CP001821_3 217 ERARVAQELHDVAAQHLAGLLSLADAAVDLS--DDDPDTALALVTEV 261

relarealaevRrllgdLR.paal<-*
r+ +r + a + +l+dLR+p ++
CP001821_3 262 RAEGRFTAASIYGALSDLRsPEGE 285

CP001821_0077: domain 1 of 1, from 193 to 247: score 36.3, E = 1.7e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R R+ HD+vg +L+a+ l+l++ar + ++
CP001821_0 193 ERERVVRDVHDTVGRGLAAVLLHLDAAR---------------IPAA 224

relarealaevRrllgdLRpaal<-*
r++ar alae+Rr++ +L p l
CP001821_0 225 RTAARAALAETRRTVLGLGPELL 247


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 3 0|=
-13 30 0|====
-12 43 37|====*
-11 81 305|========= *
-10 292 709|================================= *
-9 464 805|==================================================== *
-8 494 621|======================================================= *
-7 503 390|===========================================*============
-6 406 221|========================*=====================
-5 406 118|=============*================================
-4 215 61|======*=================
-3 144 31|===*============
-2 87 16|=*========
-1 58 8|*======
0 31 4|*===
1 21 2|*==
2 17 1|*=
3 11 0|==
4 4 0|=
5 4 0|=
6 2 0|=
7 0 0|
8 0 0|
9 1 0|=
10 0 0|
11 0 0|
12 1 0|=
13 0 0|
14 1 0|=
15 1 0|=
16 1 0|=
> 17 16 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2848.2114
P(chi-square) = 0

Total sequences searched: 3337

Whole sequence top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 15
Satisfying E cutoff: 15
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: