Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

2 accessions found for Sphaerobacter thermophilus DSM 20745  

Data for CP001823  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001823.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001823_1547 CDS_1701443-1702756 86.7 1.8e-25 1
CP001823_0199 CDS_223404-224666 70.6 9.5e-21 1
CP001823_0156 CDS_174783-173305 69.2 2.5e-20 1
CP001823_0244 CDS_273662-272292 66.9 1.2e-19 1
CP001823_0809 CDS_898530-897442 51.2 5.1e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001823_1547 1/1 215 282 .. 1 70 [] 86.7 1.8e-25
CP001823_0199 1/1 206 274 .. 1 70 [] 70.6 9.5e-21
CP001823_0156 1/1 259 327 .. 1 70 [] 69.2 2.5e-20
CP001823_0244 1/1 240 308 .. 1 70 [] 66.9 1.2e-19
CP001823_0809 1/1 165 232 .. 1 70 [] 51.2 5.1e-15

Alignments of top-scoring domains:
CP001823_1547: domain 1 of 1, from 215 to 282: score 86.7, E = 1.8e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i ++le+a+ ++ ++++ ++r++++++
CP001823_1 215 ERQRLAREIHDTLAQGFTSIVMHLEAAEPHI--PAEATALRRHVEQA 259

relarealaevRrllgdLRpaal<-*
r++ar++l+++Rrl+++LRp +l
CP001823_1 260 RATARDSLNDARRLVWALRPEQL 282

CP001823_0199: domain 1 of 1, from 206 to 274: score 70.6, E = 9.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI RELHD++ Q L+ ++l+le+ +r++ + dp++a++++ +i
CP001823_0 206 ERRRIGRELHDGIVQDLAYLRLKLEMMARII--PQDPARAQDEALQI 250

relarealaevRrllgdLR.paal<-*
e +++++a +R+++gdLR+p
CP001823_0 251 TEQINRSIAALRETIGDLRrPRPP 274

CP001823_0156: domain 1 of 1, from 259 to 327: score 69.2, E = 2.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs++Q L ++ ++++a+ ll+ e+a e++ ++
CP001823_0 259 ERERIAREMHDSLAQVLGYVNTKAQAAQELLR-NGQQERASEQIGQL 304

relarealaevRrllgdLRpaal<-*
+++ar+a+a+vR+ + +LR++ +
CP001823_0 305 AQAARDAYADVRENILGLRTSLE 327

CP001823_0244: domain 1 of 1, from 240 to 308: score 66.9, E = 1.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER RIARE+HD+v+Q+L+ + ++l+++ ll ++ +++ ar+++++
CP001823_0 240 ERGRIAREMHDGVAQMLAYVLVKLGTVDGLL--AAGAAdTARAEIET 284

irelarealaevRrllgdLRpaal<-*
+r++a+ a+++vR+ + +LR ++
CP001823_0 285 MRQAAESAYTDVREQILGLRLVTD 308

CP001823_0809: domain 1 of 1, from 165 to 232: score 51.2, E = 5.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A+ D+ +Q+L+ i l +e+++rl+ ++dpe+ar++l e+
CP001823_0 165 ERLRLAQRVVDGPAQALANILLEAEVCERLM--ERDPEQARTELGEL 209

relarealaevRrllgdLRpaal<-*
r+ a +al+e Rr+l +LRp +l
CP001823_0 210 RRVAADALSESRRMLLELRPVVL 232


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-15 1 0|=
-14 3 0|=
-13 11 0|==
-12 33 27|====*=
-11 66 223|=========== *
-10 192 518|================================ *
-9 330 589|======================================================= *
-8 327 453|======================================================= *
-7 347 285|===============================================*==========
-6 320 161|==========================*===========================
-5 318 86|==============*======================================
-4 165 45|=======*====================
-3 102 23|===*=============
-2 88 11|=*=============
-1 44 6|*=======
0 38 3|*======
1 15 1|*==
2 7 0|==
3 7 0|==
4 6 0|=
5 2 0|=
6 5 0|=
7 0 0|
8 2 0|=
9 0 0|
10 0 0|
11 1 0|=
12 1 0|=
> 13 8 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2563.2739
P(chi-square) = 0

Total sequences searched: 2439

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: