Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
14 projects found  

2 accessions found for Sphaerobacter thermophilus DSM 20745  

Data for CP001824  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001824.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001824_0764 CDS_917546-914895 69.0 1.2e-20 1
CP001824_0869 CDS_1044254-1045921 59.8 6.3e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001824_0764 1/1 676 743 .. 1 70 [] 69.0 1.2e-20
CP001824_0869 1/1 346 413 .. 1 70 [] 59.8 6.3e-18

Alignments of top-scoring domains:
CP001824_0764: domain 1 of 1, from 676 to 743: score 69.0, E = 1.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A+E+HD+++Q+L+ai+l+l+la + l + pe+a++ ++++
CP001824_0 676 ERGRLAQEIHDTLAQGLTAISLHLDLADAYL--PHKPEQAADKVRRA 720

relarealaevRrllgdLRpaal<-*
el r+ l+e+Rr + dLR a l
CP001824_0 721 LELTRQNLEEARRSVLDLRAARL 743

CP001824_0869: domain 1 of 1, from 346 to 413: score 59.8, E = 6.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L +i+l le++ + + d+ + r ++++
CP001824_0 346 ERNRLAREIHDTLAQGLIGIILYLERLDLEI--PQDDRRFRPLVERA 390

relarealaevRrllgdLRpaal<-*
lar l+e+Rr ++dLR a l
CP001824_0 391 LSLARGNLEEARRSVHDLRAAPL 413


Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-14 2 0|=
-13 6 0|==
-12 11 11|===*
-11 19 95|======= *
-10 83 222|============================ *
-9 166 252|======================================================== *
-8 132 194|============================================ *
-7 140 122|========================================*======
-6 137 69|======================*=======================
-5 141 37|============*==================================
-4 82 19|======*=====================
-3 48 9|==*=============
-2 32 5|=*=========
-1 18 2|*=====
0 6 1|*=
1 4 0|==
2 5 0|==
3 3 0|=
4 3 0|=
5 2 0|=
6 0 0|
7 1 0|=
8 0 0|
9 0 0|
> 10 5 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1047.0398
P(chi-square) = 0

Total sequences searched: 1046

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: