Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

2 accessions found for Thermobaculum terrenum ATCC BAA-798  

Data for CP001825  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001825.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001825_0791 CDS_853822-854865 74.8 4.3e-22 1
CP001825_0299 CDS_320910-323156 64.5 4.8e-19 1
CP001825_0634 CDS_698841-703787 62.6 1.7e-18 1
CP001825_1100 CDS_1196680-1198074 61.9 2.6e-18 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001825_0791 1/1 140 207 .. 1 70 [] 74.8 4.3e-22
CP001825_0299 1/1 542 609 .. 1 70 [] 64.5 4.8e-19
CP001825_0634 1/1 1224 1292 .. 1 70 [] 62.6 1.7e-18
CP001825_1100 1/1 244 312 .. 1 70 [] 61.9 2.6e-18

Alignments of top-scoring domains:
CP001825_0791: domain 1 of 1, from 140 to 207: score 74.8, E = 4.3e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE HD+ +Q ++ +++ +e ++rll ++ p+ + +l++i
CP001825_0 140 ERSRLAREVHDGPAQVMANAIMAIEYCERLL--ERRPQSLPSELHRI 184

relarealaevRrllgdLRpaal<-*
+ +r++l+evRr + dLRp++l
CP001825_0 185 KLSLRQGLEEVRRFIYDLRPSDL 207

CP001825_0299: domain 1 of 1, from 542 to 609: score 64.5, E = 4.8e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +Q+L a++ ++ +r l + pe+a++ ++ +
CP001825_0 542 ERRRIARDLHDDTAQALIALSRRIDSLREDL--GDLPEAAQRKIEDL 586

relarealaevRrllgdLRpaal<-*
++l +++la vRr +dLRp++l
CP001825_0 587 KALTDQTLASVRRFSRDLRPSIL 609

CP001825_0634: domain 1 of 1, from 1224 to 1292: score 62.6, E = 1.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+++Q L ++ +++++ r+l + eea +l+++
CP001825_0 1224 ERARIAREMHDTLAQVLGYVNTKAQAVYRMLS-HGSVEEAVVQLEQL 1269

relarealaevRrllgdLRpaal<-*
+ +ar a+a++R+ + +LR++++
CP001825_0 1270 ASAARSAYADLREDILGLRTSVD 1292

CP001825_1100: domain 1 of 1, from 244 to 312: score 61.9, E = 2.6e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HDs++Q L+ ++ + ++ ++ll+ + + ++a + l ++
CP001825_1 244 ERERIAREMHDSLAQVLTYVTTKGHATQMLLE-RGELDKASKNLSQL 289

relarealaevRrllgdLRpaal<-*
++ar a+++vR+ + +LR++++
CP001825_1 290 VDAARSAYSDVREQILALRTSQE 312


Histogram of all scores:
score obs exp (one = represents 6 sequences)
----- --- ---
-14 4 0|=
-13 19 0|====
-12 30 20|===*=
-11 87 170|=============== *
-10 285 395|================================================ *
-9 335 448|======================================================== *
-8 263 345|============================================ *
-7 276 217|====================================*=========
-6 200 123|====================*=============
-5 154 66|==========*===============
-4 76 34|=====*=======
-3 61 17|==*========
-2 21 9|=*==
-1 16 4|*==
0 14 2|*==
1 4 1|*
2 4 0|=
3 3 0|=
4 0 0|
5 2 0|=
6 0 0|
> 7 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 476.8640
P(chi-square) = 0

Total sequences searched: 1859

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: