hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001826.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001826_0655 CDS_724181-722811 73.3 6.4e-22 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001826_0655 1/1 246 314 .. 1 70 [] 73.3 6.4e-22
Alignments of top-scoring domains:
CP001826_0655: domain 1 of 1, from 246 to 314: score 73.3, E = 6.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD+++Q L ++l+++++r+ll+ + e+++++l+++
CP001826_0 246 ERARIAREMHDGLAQVLGYVNLKTQAVRTLLE-AGQLERVEQELERM 291
relarealaevRrllgdLRpaal<-*
+++area++++R+ + +LR++ +
CP001826_0 292 EQAAREAYTDLRENILALRTSPD 314
Histogram of all scores:
score obs exp (one = represents 3 sequences)
----- --- ---
-13 12 0|====
-12 18 10|===*==
-11 33 89|=========== *
-10 113 206|====================================== *
-9 135 234|============================================= *
-8 143 181|================================================ *
-7 128 113|=====================================*=====
-6 108 64|=====================*==============
-5 126 34|===========*==============================
-4 63 18|=====*===============
-3 36 9|==*=========
-2 22 4|=*======
-1 15 2|*====
0 8 1|*==
1 4 0|==
2 2 0|=
3 4 0|==
4 0 0|
5 0 0|
6 1 0|=
> 7 2 -|=
% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 595.4176
P(chi-square) = 0
Total sequences searched: 973
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K