Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Gardnerella vaginalis 409-05  

Data for CP001849  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001849.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001849_0601 CDS_724285-721736 80.0 8.4e-24 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001849_0601 1/2 232 299 .. 1 70 [] 69.4 1.1e-20

Alignments of top-scoring domains:
CP001849_0601: domain 1 of 2, from 232 to 299: score 69.4, E = 1.1e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD v+++Ls i++q+++ r+++ +kd a+++++ i
CP001849_0 232 ERARIARDMHDIVAHTLSIIIVQADGGRYAA--TKDISLAKKTMHII 276

relarealaevRrllgdLRpaal<-*
+ a++a ++Rrll +L +a
CP001849_0 277 KNEAERAVHDMRRLLEALTDAPS 299


Histogram of all scores:
score obs exp (one = represents 5 sequences)
----- --- ---
-15 2 0|=
-14 14 0|===
-13 39 0|========
-12 52 14|==*========
-11 82 115|================= *
-10 191 267|======================================= *
-9 245 303|================================================= *
-8 197 234|======================================== *
-7 132 147|=========================== *
-6 78 83|================*
-5 100 44|========*===========
-4 51 23|====*======
-3 31 11|==*====
-2 19 6|=*==
-1 11 3|*==
0 5 1|*
1 2 0|=
2 2 0|=
3 2 0|=
> 4 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 311.6183
P(chi-square) = 0

Total sequences searched: 1258

Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: