Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Conexibacter woesei DSM 14684  

Data for CP001854  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001854.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001854_4729 CDS_5069304-5070485 92.1 1.1e-26 1
CP001854_1607 CDS_1696740-1697918 90.5 3.2e-26 1
CP001854_3748 CDS_4000925-4002187 86.8 3.9e-25 1
CP001854_4830 CDS_5174852-5176036 85.3 1.1e-24 1
CP001854_4921 CDS_5277908-5275527 84.6 1.7e-24 2
CP001854_1263 CDS_1335105-1333804 82.1 9.6e-24 1
CP001854_0675 CDS_722174-721035 77.7 1.8e-22 1
CP001854_0357 CDS_366017-364935 74.3 1.9e-21 1
CP001854_0613 CDS_649103-650509 74.3 1.9e-21 1
CP001854_5625 CDS_6058883-6057576 74.2 2e-21 1
CP001854_1225 CDS_1288812-1289816 72.8 5.1e-21 1
CP001854_3970 CDS_4235351-4234155 71.5 1.3e-20 1
CP001854_3699 CDS_3952511-3950751 70.1 3.2e-20 1
CP001854_2459 CDS_2631937-2630762 69.0 7.2e-20 1
CP001854_3888 CDS_4148443-4149729 68.4 1e-19 1
CP001854_5597 CDS_6029708-6028530 68.3 1.1e-19 1
CP001854_0261 CDS_267626-268915 66.0 5.4e-19 1
CP001854_0367 CDS_376129-374888 65.8 5.9e-19 1
CP001854_4583 CDS_4910719-4909466 58.8 6.9e-17 1
CP001854_0549 CDS_577716-576568 58.0 1.2e-16 1
CP001854_4950 CDS_5304450-5305430 52.7 4.5e-15 1
CP001854_3744 CDS_3997919-3996792 50.3 2.2e-14 1
CP001854_1289 CDS_1366560-1367720 43.3 2.5e-12 1
CP001854_1494 CDS_1586070-1587677 39.9 2.6e-11 1
CP001854_2513 CDS_2692628-2691885 39.8 2.9e-11 1
CP001854_3032 CDS_3252357-3254054 38.8 5.5e-11 1
CP001854_5139 CDS_5530938-5529325 34.5 1e-09 2
CP001854_2453 CDS_2621941-2621138 33.7 1.7e-09 2
CP001854_2376 CDS_2531131-2532987 31.8 6.4e-09 1
CP001854_0319 CDS_329808-328660 30.9 1.2e-08 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001854_4729 1/1 188 255 .. 1 70 [] 92.1 1.1e-26
CP001854_1607 1/1 185 252 .. 1 70 [] 90.5 3.2e-26
CP001854_3748 1/1 182 249 .. 1 70 [] 86.8 3.9e-25
CP001854_4830 1/1 188 256 .. 1 70 [] 85.3 1.1e-24
CP001854_1263 1/1 195 262 .. 1 70 [] 82.1 9.6e-24
CP001854_0675 1/1 179 246 .. 1 70 [] 77.7 1.8e-22
CP001854_0357 1/1 149 216 .. 1 70 [] 74.3 1.9e-21
CP001854_0613 1/1 223 289 .. 1 70 [] 74.3 1.9e-21
CP001854_5625 1/1 216 283 .. 1 70 [] 74.2 2e-21
CP001854_1225 1/1 124 190 .. 1 70 [] 72.8 5.1e-21
CP001854_3970 1/1 197 265 .. 1 70 [] 71.5 1.3e-20
CP001854_3699 1/1 396 463 .. 1 70 [] 70.1 3.2e-20
CP001854_2459 1/1 177 244 .. 1 70 [] 69.0 7.2e-20
CP001854_3888 1/1 239 306 .. 1 70 [] 68.4 1e-19
CP001854_5597 1/1 200 267 .. 1 70 [] 68.3 1.1e-19
CP001854_0261 1/1 220 287 .. 1 70 [] 66.0 5.4e-19
CP001854_0367 1/1 184 251 .. 1 70 [] 65.8 5.9e-19
CP001854_4583 1/1 221 288 .. 1 70 [] 58.8 6.9e-17
CP001854_0549 1/1 178 243 .. 1 70 [] 58.0 1.2e-16
CP001854_4921 2/2 567 629 .. 1 65 [. 54.5 1.3e-15
CP001854_4950 1/1 122 187 .. 1 70 [] 52.7 4.5e-15
CP001854_3744 1/1 178 244 .. 1 70 [] 50.3 2.2e-14
CP001854_1289 1/1 184 250 .. 1 70 [] 43.3 2.5e-12
CP001854_1494 1/1 330 399 .. 1 70 [] 39.9 2.6e-11
CP001854_2513 1/1 54 117 .. 1 70 [] 39.8 2.9e-11
CP001854_3032 1/1 387 442 .. 1 70 [] 38.8 5.5e-11
CP001854_2376 1/1 385 451 .. 1 70 [] 31.8 6.4e-09
CP001854_0319 1/1 171 258 .. 1 70 [] 30.9 1.2e-08
CP001854_2453 2/2 78 129 .. 1 54 [. 30.4 1.6e-08
CP001854_4921 1/2 184 251 .. 1 70 [] 30.1 2e-08

Alignments of top-scoring domains:
CP001854_4729: domain 1 of 1, from 188 to 255: score 92.1, E = 1.1e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R AR+LHD +g+sLs+i+l++ela rll ++ p+ea+++++e+
CP001854_4 188 ERERFARDLHDLLGHSLSVITLKAELAGRLL--PARPDEAQRHVREL 232

relarealaevRrllgdLRpaal<-*
++ areal evR++++++R ++l
CP001854_4 233 EAVAREALGEVRETVSGYRRPTL 255

CP001854_1607: domain 1 of 1, from 185 to 252: score 90.5, E = 3.2e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD v+++ s++ +q+++arrll ++dp+ ar+al+ +
CP001854_1 185 ERARIARELHDIVAHGVSVMVVQSGAARRLL--ESDPATARRALEHV 229

relarealaevRrllgdLRpaal<-*
++++r+alae+Rr+lg+LR a++
CP001854_1 230 EATGRDALAEMRRMLGVLRRADD 252

CP001854_3748: domain 1 of 1, from 182 to 249: score 86.8, E = 3.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++L++++ +++ar + + +peea++a++++
CP001854_3 182 ERGRIARELHDVVAHNLTVMIALADGARLTA--AQAPEEADAAMRTV 226

relarealaevRrllgdLRpaal<-*
+++real e+Rrllg+LR+++
CP001854_3 227 SATGREALGEMRRLLGVLRDSGS 249

CP001854_4830: domain 1 of 1, from 188 to 256: score 85.3, E = 1.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++++sL++i +q+++ ++++ ++ pe+a++ l +i
CP001854_4 188 ERLRIARELHDVLAHSLAMIHVQASTGAHVV--ARRPEQAEQVLSAI 232

relarealaevRrllgdLR.paal<-*
++++ eala++R ++g+LR +aa+
CP001854_4 233 KQASGEALADLRTTVGVLRaDAAD 256

CP001854_1263: domain 1 of 1, from 195 to 262: score 82.1, E = 9.6e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIARE HD vg++L+ai+lq+ + +r++ ++dp+ are++ +i
CP001854_1 195 DRMRIAREVHDIVGHALAAITLQARAGQRQI--TRDPAVARETFVQI 239

relarealaevRrllgdLRpaal<-*
++ a++al e+R+++g++R + +
CP001854_1 240 EGVASRALGETREAVGVIRSGSE 262

CP001854_0675: domain 1 of 1, from 179 to 246: score 77.7, E = 1.8e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD+v+++ sai++q+++ +++ + pe+a++ l +i
CP001854_0 179 ERVALARELHDTVAHHVSAIAVQAQAGVAVA--GTQPEKAAQVLSAI 223

relarealaevRrllgdLRpaal<-*
+ a+++lae+R ++++LR+++
CP001854_0 224 ESEASRTLAEMRSTVRVLREGEA 246

CP001854_0357: domain 1 of 1, from 149 to 216: score 74.3, E = 1.9e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E aRIARELHD++++s s+i +q+ +a +++ d+ p++ar+al++i
CP001854_0 149 EQARIARELHDVIAHSVSVIVVQATAADHVF--DERPDRARAALRAI 193

relarealaevRrllgdLRpaal<-*
++++re+lae+Rrll +LRp +
CP001854_0 194 EATGRETLAELRRLLPALRPFDA 216

CP001854_0613: domain 1 of 1, from 223 to 289: score 74.3, E = 1.9e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q+L++i q+++a+ ++ ++ pe+ r++l+++
CP001854_0 223 ERQRMAREIHDTLAQGLTGIVAQIQAAE-QA--AERPERWRRHLRTA 266

relarealaevRrllgdLRpaal<-*
++lare+lae+Rr +++ Rp al
CP001854_0 267 AQLARESLAEARRSVQAVRPEAL 289

CP001854_5625: domain 1 of 1, from 216 to 283: score 74.2, E = 2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD++++++s+++l++++++ + d++ ee+ ea+ +
CP001854_5 216 ERRRIAREMHDVLAHRISLLSLHAGALEFRP--DAPREEISEAAGVV 260

relarealaevRrllgdLRpaal<-*
r++a+ al+++R+++g+LR+++
CP001854_5 261 RATAHAALEDLRDVIGVLRDDDG 283

CP001854_1225: domain 1 of 1, from 124 to 190: score 72.8, E = 5.1e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+vgQ+L+a+ lqle+ +r l +++p r++++e+
CP001854_1 124 ERIRIARELHDEVGQTLTAVVLQLERSAREL--RDAP-VQRAHVEEA 167

relarealaevRrllgdLRpaal<-*
relar+a +evR+++++LRp al
CP001854_1 168 RELARTAAEEVREIARRLRPEAL 190

CP001854_3970: domain 1 of 1, from 197 to 265: score 71.5, E = 1.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDs g+++ +i +q+++ar++l ++ p++a ea++ i
CP001854_3 197 ERSRIARELHDSAGHAINSILIQAGAARTVL--ATQPQRALEAIASI 241

relarealaevRrllgdLR.paal<-*
+++ar++++++ +lg+LR+++a
CP001854_3 242 ETIARTTIDDLDGILGRLRrEGAA 265

CP001854_3699: domain 1 of 1, from 396 to 463: score 70.1, E = 3.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a++l l+ a+ ++ +kdpe+ar ++e+
CP001854_3 396 ERRRIERDLHDGAQQRLVALALTLGIAENQV--EKDPEQARGLIREA 440

relarealaevRrllgdLRpaal<-*
r+ ar al+e+R+l+++++pa+l
CP001854_3 441 RDEARLALEELRELARGIHPAIL 463

CP001854_2459: domain 1 of 1, from 177 to 244: score 69.0, E = 7.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IAR+ HD vg++L+a++lq+ ar++l ++dp++a+eal+++
CP001854_2 177 QRREIARDVHDFVGHGLAAVMLQVTSARHVL--RRDPDAAEEALRTA 221

relarealaevRrllgdLRpaal<-*
+e +r++++e+Rr+++ LR +++
CP001854_2 222 EEVGRHSMRELRRTVTLLRSDEE 244

CP001854_3888: domain 1 of 1, from 239 to 306: score 68.4, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a++l l++a+ + d+dp++are l+e+
CP001854_3 239 ELQRIERDLHDGAQARLVALALNLGMAEDKF--DSDPDQARELLAEA 283

relarealaevRrllgdLRpaal<-*
r+ a++al+e+R+l+++++p++l
CP001854_3 284 RGEAKTALTELRDLARGIHPPIL 306

CP001854_5597: domain 1 of 1, from 200 to 267: score 68.3, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R A +LHD+ g++L ai++++elarrl+ +d+++ar++++ +
CP001854_5 200 ERLRFAADLHDVQGHQLQAIAMKAELARRLV--GSDDDAARAHAADV 244

relarealaevRrllgdLRpaal<-*
++la +alae+R++++++R +l
CP001854_5 245 QQLALTALAETRAIVHGYRRVGL 267

CP001854_0261: domain 1 of 1, from 220 to 287: score 66.0, E = 5.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
Ra +AR+LHDsvg++ +a++lq+ +arr+l ++dp+ a++al++i
CP001854_0 220 ARAELARDLHDSVGHAVTAATLQAAAARRVL--ARDPQFAADALKAI 264

relarealaevRrllgdLRpaal<-*
++ +r+al+e+ ++l LR+ ++
CP001854_0 265 EQQGRRALDELDHVLASLRDEDD 287

CP001854_0367: domain 1 of 1, from 184 to 251: score 65.8, E = 5.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARE+HD+++++ s++ l++++++ +l +d ++a++a+++i
CP001854_0 184 ERTAIAREMHDVIAHRVSLMVLHAGALELAL--GRDHGQAEAAAHTI 228

relarealaevRrllgdLRpaal<-*
r+++r+al+e+ +++g+LR ++
CP001854_0 229 RTTGRQALRELGEIVGVLRADDG 251

CP001854_4583: domain 1 of 1, from 221 to 288: score 58.8, E = 6.9e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l+lar l + +ea++ ++++
CP001854_4 221 ERRRIERDLHDGAQQQLVALAMTLDLARIEL--EGSGGEAARLVERA 265

relarealaevRrllgdLRpaal<-*
++ a +++ae+R+l+++++p++l
CP001854_4 266 HAQATRTIAELRDLIHAIHPPIL 288

CP001854_0549: domain 1 of 1, from 178 to 243: score 58.0, E = 1.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+ HD+ g++Lsai+lq+ +a r + +++ ar+al++i
CP001854_0 178 ERLRIARDVHDVTGHHLSAISLQAAGASRTT--EDP--IARAALARI 220

relarealaevRrllgdLRpaal<-*
+e+ al ++R++lg L+ ++
CP001854_0 221 HEATAAALGQTRHALGILKQTGP 243

CP001854_4921: domain 2 of 2, from 567 to 629: score 54.5, E = 1.3e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARELHD vg++L++i+lq +a +ll d p+ a+ al+++
CP001854_4 567 ERLRVARELHDLVGHGLTSITLQCAVADQLL--DVRPADAAVALTAV 611

relarealaevRrllgdL<-*
+e ++e +e+ +ll +L
CP001854_4 612 AEVGEEVVRELHQLLAAL 629

CP001854_4950: domain 1 of 1, from 122 to 187: score 52.7, E = 4.5e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR ARELHD+ Q+L+a+ + l+ r +k pe re++ +
CP001854_4 122 ERARWARELHDETLQGLAALHVLLSSGVR----AKTPELMRERIGLA 164

relarealaevRrllgdLRpaal<-*
+e ++ a++ +R l+ dLRpaal
CP001854_4 165 QEQIEGAMENLRGLINDLRPAAL 187

CP001854_3744: domain 1 of 1, from 178 to 244: score 50.3, E = 2.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+++ql++a+ +l ++ p ++e ++++
CP001854_3 178 ELRRIERDLHDGAQARLVALSMQLGRAEERL--EDQP-DVAELVRRA 221

relarealaevRrllgdLRpaal<-*
r+ a a++e+R+l++++ p++l
CP001854_3 222 RGEAGAAIKELRDLARGIAPPVL 244

CP001854_1289: domain 1 of 1, from 184 to 250: score 43.3, E = 2.5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R ARELHD+ Q+L ++ + l+ a+r+ ++p +++ a++++
CP001854_1 184 ERRRWARELHDETLQGLGGLQVLLSSALRRS---SEPSQVEGAVRAA 227

relarealaevRrllgdLRpaal<-*
e + + ++ +R l+++LRpaal
CP001854_1 228 VEEIGTEIEKLRTLITELRPAAL 250

CP001854_1494: domain 1 of 1, from 330 to 399: score 39.9, E = 2.6e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHDs +L a++++l+la+ ++++ + e + ++l ++
CP001854_1 330 ERRRIERDLHDSGQNRLVALRIKLDLAAEEAEQEGASELLHARLVAL 376

relarealaevRrllgdLRpaal<-*
e a++al+ vR+++++ p+ l
CP001854_1 377 GEEAQDALDAVRAIARGVYPPLL 399

CP001854_2513: domain 1 of 1, from 54 to 117: score 39.8, E = 2.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IAR+ HD+++Q L+ i+ ql+++ + + + ++e+
CP001854_2 54 QRRAIARDVHDGIAQELAFIAAQLGRLDQGA-------GDGDLAHEL 93

relarealaevRrllgdLR.paal<-*
r++ar+al e+R ++ LR p++
CP001854_2 94 RAAARRALHEARLTIELLRaPPDV 117

CP001854_3032: domain 1 of 1, from 387 to 442: score 38.8, E = 5.5e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD++ +L +++q+++ + + ++
CP001854_3 387 ERRRIARDLHDGLQSRLVFLAVQAGTGA--------------DAGTV 419

relarealaevRrllgdLRpaal<-*
r+ ++ a++e+R+l+ + p++l
CP001854_3 420 RAGIEAAIDELRDLVEGVMPTQL 442

CP001854_2376: domain 1 of 1, from 385 to 451: score 31.8, E = 6.4e-09
*->ERaRIARELHDsvgQsLsaiklql.elarrlldsdkdpeearealde
ER+RIAR+LHD+v +L +++l ++elarr d+ ++ar+ ++e
CP001854_2 385 ERRRIARDLHDGVQGRLVLLALRAnELARR----DDSSAAARADAAE 427

irelarealaevRrllgdLRpaal<-*
+r+ ++ la + +l+++ paal
CP001854_2 428 LRRELDGVLAALGELVQGVLPAAL 451

CP001854_0319: domain 1 of 1, from 171 to 258: score 30.9, E = 1.2e-08
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.........
ER+R+ R+LHD+ Q+L i l l la+ + +++++++ ++++
CP001854_0 171 ERRRLVRDLHDGAQQRLVRILLSLRLAANEA--TRAAGgraehgdaa 215

...........earealdeirelarealaevRrllgdLRpaal<-*
+++ ++ +++++re lde++ + a+ae+R+l ++L+p++l
CP001854_0 216 ggdaatdaggeQLRELLDEAASDTQAAIAELRDLGSGLHPQIL 258

CP001854_2453: domain 2 of 2, from 78 to 129: score 30.4, E = 1.6e-08
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ +A ++HD+vg++ s++ + +++ar++l ++dp++a +ld+i
CP001854_2 78 ARRALADDIHDTVGHGVSLAGVLAGAARAAL--ATDPPAAVLTLDRI 122

relarea<-*
++ + e+
CP001854_2 123 AAVVAET 129

CP001854_4921: domain 1 of 2, from 184 to 251: score 30.1, E = 2e-08
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELH +v+ a+ + +ar l +++++ ar+al ++
CP001854_4 184 ERTRIARELHAVVSGCVRAVLDEIAVARSTL--AAANGTARAALGRA 228

relarealaevRrllgdLRpaal<-*
r+++++a++e+Rr+l LR a
CP001854_4 229 RRASQQAMSEMRRMLVLLRSEAP 251


Histogram of all scores:
score obs exp (one = represents 15 sequences)
----- --- ---
-14 4 0|=
-13 28 0|==
-12 50 66|====*
-11 114 542|======== *
-10 352 1257|======================== *
-9 739 1428|================================================== *
-8 820 1100|======================================================= *
-7 874 692|==============================================*============
-6 754 391|==========================*========================
-5 866 210|=============*============================================
-4 463 109|=======*=======================
-3 301 56|===*=================
-2 199 28|=*============
-1 117 14|*=======
0 77 7|*=====
1 48 3|*===
2 29 1|*=
3 14 0|=
4 14 0|=
5 4 0|=
6 8 0|=
7 3 0|=
8 0 0|
9 0 0|
10 1 0|=
> 11 35 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 8395.9775
P(chi-square) = 0

Total sequences searched: 5914

Whole sequence top hits:
tophits_s report:
Total hits: 30
Satisfying E cutoff: 30
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 30
Satisfying E cutoff: 30
Total memory: 31K


Acknowledgements:

This research is funded by:

Developed by: