Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Geodermatophilus obscurus DSM 43160  

Data for CP001867  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001867.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001867_3816 CDS_4260188-4261306 90.6 2.5e-26 1
CP001867_1891 CDS_2087730-2088893 84.0 2.2e-24 1
CP001867_0978 CDS_1087628-1088863 83.4 3.2e-24 1
CP001867_1544 CDS_1699523-1700632 78.7 8e-23 1
CP001867_2747 CDS_3070036-3069035 78.1 1.2e-22 1
CP001867_4560 CDS_5050729-5049467 75.7 6e-22 1
CP001867_1868 CDS_2057159-2058328 68.2 9.9e-20 2
CP001867_4661 CDS_5156575-5155256 50.3 1.8e-14 1
CP001867_1061 CDS_1179361-1178027 47.7 1.1e-13 1
CP001867_4543 CDS_5036626-5038257 38.8 4.7e-11 1
CP001867_2910 CDS_3268663-3270114 36.4 2.3e-10 1
CP001867_3225 CDS_3613438-3615258 33.5 1.7e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001867_3816 1/1 175 243 .. 1 70 [] 90.6 2.5e-26
CP001867_1891 1/1 187 254 .. 1 70 [] 84.0 2.2e-24
CP001867_0978 1/1 214 281 .. 1 70 [] 83.4 3.2e-24
CP001867_1544 1/1 174 237 .. 1 66 [. 78.7 8e-23
CP001867_2747 1/1 134 198 .. 1 70 [] 78.1 1.2e-22
CP001867_4560 1/1 230 297 .. 1 70 [] 75.7 6e-22
CP001867_1868 2/2 182 249 .. 1 70 [] 68.0 1.1e-19
CP001867_4661 1/1 229 295 .. 1 70 [] 50.3 1.8e-14
CP001867_1061 1/1 243 307 .. 1 70 [] 47.7 1.1e-13
CP001867_4543 1/1 348 415 .. 1 70 [] 38.8 4.7e-11
CP001867_2910 1/1 273 340 .. 1 70 [] 36.4 2.3e-10
CP001867_3225 1/1 335 402 .. 1 70 [] 33.5 1.7e-09

Alignments of top-scoring domains:
CP001867_3816: domain 1 of 1, from 175 to 243: score 90.6, E = 2.5e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR++HD++g++L+++ +q+++ar++l +dpe+a++ l+ +
CP001867_3 175 ERNRLARDIHDGLGHHLTVVQMQVQAARAQL--SSDPERADAVLAKA 219

relarealaevRrllgdLR.paal<-*
++ a++alaevRr + +LR+p +
CP001867_3 220 QQQASDALAEVRRSVAALRgPRTA 243

CP001867_1891: domain 1 of 1, from 187 to 254: score 84.0, E = 2.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v++++s +++q+++ar+ll d+dp++ar+ald +
CP001867_1 187 ERLRIARELHDVVAHHISIVNVQAGVARHLL--DADPDQARAALDLV 231

relarealaevRrllgdLRpaal<-*
r+++++ l+e+ ++g LR+a++
CP001867_1 232 RDASKTVLSEMSTVVGLLRTAGE 254

CP001867_0978: domain 1 of 1, from 214 to 281: score 83.4, E = 3.2e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A+E HD+++Q+ ++i + +++a +ll ++dpe+are+l+ i
CP001867_0 214 ERERLAQEVHDTLAQGYTSIVVLAQTADALL--PADPEAARERLAVI 258

relarealaevRrllgdLRpaal<-*
+e ar+ lae+R+++ ++Rp al
CP001867_0 259 EEVARDNLAEARAVVAAFRPVAL 281

CP001867_1544: domain 1 of 1, from 174 to 237: score 78.7, E = 8e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g+sLs+i+l++ela rl+ ++dp++ar++++ +
CP001867_1 174 ERLRFARDLHDLLGHSLSLIALKSELAGRLA--EADPARARAEMADV 218

relarealaevRrllgdLR<-*
+++ar+alaevR++++++R
CP001867_1 219 EAAARRALAEVRDAVSGYR 237

CP001867_2747: domain 1 of 1, from 134 to 198: score 78.1, E = 1.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R A+ELHD+vgQsL+a+ l+l +++ d++p+ ++ ++ +
CP001867_2 134 ERRRVAQELHDEVGQSLTAVLLGLRRIA-----DRAPADLAPEIGIA 175

relarealaevRrllgdLRpaal<-*
+e+ar +l+evR+++++LRp++l
CP001867_2 176 QETARASLDEVRQVVRRLRPGVL 198

CP001867_4560: domain 1 of 1, from 230 to 297: score 75.7, E = 6e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD+ g +Lsai+++++la+ l+ ++ + a+e+l+ i
CP001867_4 230 ERLRFARDLHDVMGRNLSAIAVKSQLAAELV--RRGRDGAAEELADI 274

relarealaevRrllgdLRpaal<-*
+ a+e+l+evR++++++R ++l
CP001867_4 275 SRVAEESLREVRDVVRGYRRTDL 297

CP001867_1868: domain 2 of 2, from 182 to 249: score 68.0, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD++++++s+++l+++++ +++ d ++e + ++ i
CP001867_1 182 ERARIAREMHDVLAHRMSLVALHAGALVYRT--DLSAAETQGTAGII 226

relarealaevRrllgdLRpaal<-*
++ ++ ala++R++lg LR+++
CP001867_1 227 QANSQAALADLREILGLLRDTER 249

CP001867_4661: domain 1 of 1, from 229 to 295: score 50.3, E = 1.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.....eare
ER+RIARELHDsv+Q+ ++ + +e++r pe +++e+ e
CP001867_4 229 ERHRIARELHDSVAQHVLSAGMTIEWCR--------PEvahhgEVYE 267

aldeirelarealaevRrllgdLRpaal<-*
+l +++l rea + +R ++++L +++
CP001867_4 268 RLGHAKALTREAVERLRGAIHALSSDGH 295

CP001867_1061: domain 1 of 1, from 243 to 307: score 47.7, E = 1.1e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IA + HD+ Q L++++ l+++r + pee + ++d +
CP001867_1 243 ERRAIAADVHDGPVQDLAGVSYALSALR-----GSLPEERQPTVDKL 284

relarealaevRrllgdLRpaal<-*
+++r+a + +Rrl d+ p++l
CP001867_1 285 VGAIRHAVQSLRRLMVDIYPPDL 307

CP001867_4543: domain 1 of 1, from 348 to 415: score 38.8, E = 4.7e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+++a l l+++ r l ++ +e ++al+e
CP001867_4 348 DRDRIARDLHDHVVQRIFATGLALDRVSRSL--EETLPETAAALAER 392

relarealaevRrllgdLRpaal<-*
+ ++ ++a +R ++ +L++a++
CP001867_4 393 VDELDGTIARIRSAIFELHEADD 415

CP001867_2910: domain 1 of 1, from 273 to 340: score 36.4, E = 2.3e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA E HD Q L+a++ +++a+++ + ++e +e l++
CP001867_2 273 ERRRIAGEVHDHTVQDLTALAFEIDAAQMRG--APRNAEDAELLERT 317

relarealaevRrllgdLRpaal<-*
++ +r++ +++R ll +L pa
CP001867_2 318 AQGVRRTVEDLRSLLVALIPARG 340

CP001867_3225: domain 1 of 1, from 335 to 402: score 33.5, E = 1.7e-09
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA + HD Q+L+a+ l l+++r +l ++ ++e ++ ++++
CP001867_3 335 ERARIAADVHDDSVQALAAVDLRLGALRNRL--RARAPEEAAGVETV 379

relarealaevRrllgdLRpaal<-*
+++++ a +R ll +L +++l
CP001867_3 380 MDAVHGASVRLRSLLFELETPVL 402


Histogram of all scores:
score obs exp (one = represents 13 sequences)
----- --- ---
-14 7 0|=
-13 26 0|==
-12 56 53|====*
-11 125 440|========== *
-10 380 1023|============================== *
-9 638 1161|================================================== *
-8 638 895|================================================== *
-7 726 562|===========================================*============
-6 597 318|========================*=====================
-5 650 170|=============*====================================
-4 338 89|======*===================
-3 218 45|===*=============
-2 145 23|=*==========
-1 92 11|*=======
0 55 6|*====
1 35 3|*==
2 22 1|*=
3 18 0|==
4 10 0|=
5 7 0|=
6 6 0|=
7 4 0|=
8 0 0|
> 9 18 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 5476.2275
P(chi-square) = 0

Total sequences searched: 4811

Whole sequence top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 12
Satisfying E cutoff: 12
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: