Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Thermobispora bispora DSM 43833  

Data for CP001874  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001874.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001874_0938 CDS_1077827-1076601 99.0 6e-29 1
CP001874_1820 CDS_2129837-2131123 96.9 2.5e-28 1
CP001874_0893 CDS_1030115-1031260 86.9 2.2e-25 1
CP001874_1697 CDS_1993627-1992428 86.5 2.9e-25 1
CP001874_0222 CDS_271615-272880 83.3 2.5e-24 1
CP001874_3344 CDS_3962267-3961197 79.0 4.9e-23 1
CP001874_3497 CDS_4139311-4137842 64.0 1.3e-18 1
CP001874_2081 CDS_2446400-2445195 52.3 3.4e-15 1
CP001874_1631 CDS_1916255-1917958 46.8 1.4e-13 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001874_0938 1/1 203 270 .. 1 70 [] 99.0 6e-29
CP001874_1820 1/1 222 289 .. 1 70 [] 96.9 2.5e-28
CP001874_0893 1/1 189 256 .. 1 70 [] 86.9 2.2e-25
CP001874_1697 1/1 188 255 .. 1 70 [] 86.5 2.9e-25
CP001874_0222 1/1 226 293 .. 1 70 [] 83.3 2.5e-24
CP001874_3344 1/1 158 222 .. 1 70 [] 79.0 4.9e-23
CP001874_3497 1/1 212 279 .. 1 70 [] 64.0 1.3e-18
CP001874_2081 1/1 166 231 .. 1 70 [] 52.3 3.4e-15
CP001874_1631 1/1 373 440 .. 1 70 [] 46.8 1.4e-13

Alignments of top-scoring domains:
CP001874_0938: domain 1 of 1, from 203 to 270: score 99.0, E = 6e-29
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARELHD+v+++ s++++q+++a++++ d+dpe+ar a++++
CP001874_0 203 ERARIARELHDVVAHNVSVMIVQADGAAYAI--DTDPEQARLAMQAV 247

relarealaevRrllgdLRpaal<-*
++++r+alae+Rrl+g+LR +a
CP001874_0 248 ARTGRQALAEMRRLVGVLRQDAG 270

CP001874_1820: domain 1 of 1, from 222 to 289: score 96.9, E = 2.5e-28
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++++q+ +arr+l d +p++ar+al++i
CP001874_1 222 ERSRIARELHDVVAHHVSVMTVQAAAARRVL--DNAPDAARDALTAI 266

relarealaevRrllgdLRpaal<-*
++++r alae+R+++g+LR+++
CP001874_1 267 EQMGRAALAEMRNIVGVLRTGDP 289

CP001874_0893: domain 1 of 1, from 189 to 256: score 86.9, E = 2.2e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+AR+LHD vg++Lsai++++ela+r+ ++dp+ are+++++
CP001874_0 189 ERLRLARDLHDLVGHRLSAIAVKSELAARMS--EADPATAREEMTAV 233

relarealaevRrllgdLRpaal<-*
++lar+al+e+R++++++R ++
CP001874_0 234 QGLARTALRELREAVRGYRRLDF 256

CP001874_1697: domain 1 of 1, from 188 to 255: score 86.5, E = 2.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g++Ls++ +++e++rrl+ ++d +ea+++++ i
CP001874_1 188 ERLRFARDLHDLLGHTLSVMVVKAEAVRRLA--PRDGQEAARQAADI 232

relarealaevRrllgdLRpaal<-*
+e++r+alaevR++++++R ++
CP001874_1 233 EEIGRKALAEVRAAVTGYRGKGF 255

CP001874_0222: domain 1 of 1, from 226 to 293: score 83.3, E = 2.5e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD v Q L++++l + +a++l+ ++dp++a+++++++
CP001874_0 226 ERTRMARELHDAVTQKLFSLRLTARAAATLA--RTDPARAAQEIEQV 270

relarealaevRrllgdLRpaal<-*
++la ealae+R+++ +LRpa+l
CP001874_0 271 ERLAGEALAELRAVIVELRPAEL 293

CP001874_3344: domain 1 of 1, from 158 to 222: score 79.0, E = 4.9e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD++gQ+L+++ l l ++ d++p +re+l+++
CP001874_3 158 ERQRIAQELHDEIGQTLTVALLELKRVV-----DRAPRNLREELQAV 199

relarealaevRrllgdLRpaal<-*
+e++r +l+evR+++++LRp++l
CP001874_3 200 QETVRSSLDEVRQVARRLRPGVL 222

CP001874_3497: domain 1 of 1, from 212 to 279: score 64.0, E = 1.3e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ +++++a+rll d+d +ar+ l+ +
CP001874_3 212 ELRRIERDLHDGAQARLVAVGMMIGTAERLL--DTDRNAARAMLAKA 256

relarealaevRrllgdLRpaal<-*
re++ +al e+Rr++++++p++l
CP001874_3 257 REASADALHELRRIVRGIHPPVL 279

CP001874_2081: domain 1 of 1, from 166 to 231: score 52.3, E = 3.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IARELHD+v ++ +++ l ++ +r +kd e+ e + +i
CP001874_2 166 ERRWIARELHDTVTHAVTVMVLSAGIIRE----TKDLREVYELAGNI 208

relarealaevRrllgdLRpaal<-*
+e + +al+e+R+ll++LR ++
CP001874_2 209 EEKGVQALSELRQLLTVLRRDEV 231

CP001874_1631: domain 1 of 1, from 373 to 440: score 46.8, E = 1.4e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIA +LHD+v Q+L+a+++ l a+rl+ ++ p ea +l+ +
CP001874_1 373 DRDRIAKDLHDVVIQRLFAVAMTLMSAARLV--EERP-EASSRLQSA 416

relarealaevRrllgdLR.paal<-*
+ ++++++++R ++ L+ pa+
CP001874_1 417 IDELDDTIRQIRTTIFKLQmPAET 440


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 7 0|=
-13 25 0|===
-12 37 39|====*
-11 76 325|========= *
-10 269 754|============================== *
-9 475 856|===================================================== *
-8 458 659|=================================================== *
-7 506 414|=============================================*===========
-6 440 234|=========================*=======================
-5 486 125|=============*========================================
-4 264 65|=======*======================
-3 175 33|===*================
-2 108 17|=*==========
-1 55 8|*======
0 49 4|*=====
1 29 2|*===
2 28 1|*===
3 19 0|===
4 10 0|==
5 4 0|=
6 6 0|=
7 3 0|=
8 3 0|=
9 2 0|=
10 0 0|
> 11 12 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 3869.2646
P(chi-square) = 0

Total sequences searched: 3546

Whole sequence top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 9
Satisfying E cutoff: 9
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: