Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Cellulomonas flavigena DSM 20109  

Data for CP001964  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001964.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001964_2360 CDS_2676827-2678164 91.0 1.4e-26 1
CP001964_0811 CDS_892789-891533 87.4 1.6e-25 1
CP001964_0813 CDS_894802-893549 87.4 1.6e-25 1
CP001964_2807 CDS_3159322-3157796 74.1 1.4e-21 1
CP001964_0641 CDS_706245-704965 72.7 3.6e-21 1
CP001964_0276 CDS_318905-320185 72.0 5.7e-21 1
CP001964_3066 CDS_3449617-3448238 69.8 2.5e-20 1
CP001964_3183 CDS_3584006-3585253 67.7 1.1e-19 1
CP001964_0846 CDS_933198-934700 66.7 2.1e-19 1
CP001964_2260 CDS_2561581-2563353 62.2 4.4e-18 1
CP001964_2532 CDS_2872750-2871584 60.4 1.5e-17 1
CP001964_3285 CDS_3705467-3703752 58.7 4.6e-17 1
CP001964_3295 CDS_3713367-3714158 42.8 2.3e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001964_2360 1/1 192 259 .. 1 70 [] 91.0 1.4e-26
CP001964_0811 1/1 203 270 .. 1 70 [] 87.4 1.6e-25
CP001964_0813 1/1 201 268 .. 1 70 [] 87.4 1.6e-25
CP001964_2807 1/1 291 358 .. 1 70 [] 74.1 1.4e-21
CP001964_0641 1/1 232 299 .. 1 70 [] 72.7 3.6e-21
CP001964_0276 1/1 199 266 .. 1 70 [] 72.0 5.7e-21
CP001964_3066 1/1 269 336 .. 1 70 [] 69.8 2.5e-20
CP001964_3183 1/1 221 287 .. 1 70 [] 67.7 1.1e-19
CP001964_0846 1/1 270 337 .. 1 70 [] 66.7 2.1e-19
CP001964_2260 1/1 374 444 .. 1 70 [] 62.2 4.4e-18
CP001964_2532 1/1 182 250 .. 1 70 [] 60.4 1.5e-17
CP001964_3285 1/1 355 423 .. 1 70 [] 58.7 4.6e-17
CP001964_3295 1/1 48 113 .. 1 70 [] 42.8 2.3e-12

Alignments of top-scoring domains:
CP001964_2360: domain 1 of 1, from 192 to 259: score 91.0, E = 1.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIARE+HD v++sLs+++ q+++ r+++ ++dp++a +al +i
CP001964_2 192 ERARIAREMHDIVAHSLSVMIAQADGGRYAA--ARDPAAASRALGTI 236

relarealaevRrllgdLRpaal<-*
+e++r al+++Rrllg+LR+a
CP001964_2 237 AETGRAALTDMRRLLGVLREAPG 259

CP001964_0811: domain 1 of 1, from 203 to 270: score 87.4, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++l+++++++++ dp+++re+++ +
CP001964_0 203 ERNRIAREMHDVLAHRLSLVALHSGALEYRA--GLDPDQVRETAAVV 247

relarealaevRrllgdLRpaal<-*
r+ a++al e+R++lg LR+++
CP001964_0 248 RANAHDALGELREVLGLLRESTP 270

CP001964_0813: domain 1 of 1, from 201 to 268: score 87.4, E = 1.6e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD+++++Ls+++l+++++++++ dp+++re+++ +
CP001964_0 201 ERNRIAREMHDVLAHRLSLVALHSGALEYRA--GLDPDQVRETAAVV 245

relarealaevRrllgdLRpaal<-*
r+ a++al e+R++lg LR+++
CP001964_0 246 RANAHDALGELREVLGLLRESTP 268

CP001964_2807: domain 1 of 1, from 291 to 358: score 74.1, E = 1.4e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa+IARE+HD+v++s s+++ +++a +++ +++p++ r+a++++
CP001964_2 291 ERAHIAREMHDVVAHSVSVMIALADGADAAF--ERAPDRSRDAVRQV 335

relarealaevRrllgdLRpaal<-*
++++r ala++ r+lg+L p +
CP001964_2 336 ARTGRAALADMQRVLGALGPVGG 358

CP001964_0641: domain 1 of 1, from 232 to 299: score 72.7, E = 3.6e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARELHD+v+++ s++++ +e a + + ++ +++a+++++ i
CP001964_0 232 ERARLARELHDVVAHHVSLVAVRAESAPYSV--PDLDPRAAATFAHI 276

relarealaevRrllgdLRpaal<-*
+e ar+al e+R++l +LR +++
CP001964_0 277 AEDARTALVELRHVLAVLRRDDD 299

CP001964_0276: domain 1 of 1, from 199 to 266: score 72.0, E = 5.7e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD +++Ls+i+++++++ r++ d dpe a++a++++
CP001964_0 199 ERTAMARELHDIAAHHLSGIAVMTGAIGRQI--DVDPEGAKKAVAQV 243

relarealaevRrllgdLRpaal<-*
re + l+++R+l+ LR+a+
CP001964_0 244 REQSTAMLRDLRNLVVLLRDATP 266

CP001964_3066: domain 1 of 1, from 269 to 336: score 69.8, E = 2.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+ + l++arr++ + dp++a++al+++
CP001964_3 269 ERRRIERDLHDGAQQRLVALGVELGVARRAA--AQDPAAAAAALEAA 313

relarealaevRrllgdLRpaal<-*
++ ++e lae+R+l+++ +pa+l
CP001964_3 314 HGEVKEVLAELRDLVRGVHPAVL 336

CP001964_3183: domain 1 of 1, from 221 to 287: score 67.7, E = 1.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaR+AR+LHD+v+ +Lsa+++++e+a+ +++p++ + r+al+
CP001964_3 221 ERARMARDLHDVVAGHLSAVAIHAEAAL-----AAPPDeaRDRAALA 262

eirelarealaevRrllgdLRpaal<-*
++r+ + +al e+R+++ +LR++a+
CP001964_3 263 AVRAGSLDALGEMRAMILVLREGAD 287

CP001964_0846: domain 1 of 1, from 270 to 337: score 66.7, E = 2.1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD v+++ s+i +q+ +ar++l +d e+a++al +
CP001964_0 270 ERLRLARELHDAVAHHVSLIGVQAAAARTVL--GSDTERAAQALGHV 314

relarealaevRrllgdLRpaal<-*
+++area +e+ +lg LR++ +
CP001964_0 315 EDAAREAVSELHGILGMLRDGSD 337

CP001964_2260: domain 1 of 1, from 374 to 444: score 62.2, E = 4.4e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIAR+LHD Q+L+a +qle++rr++ ++ ++ e+ ++
CP001964_2 374 ERERIARDLHDLAIQQLFATGMQLETVRRRA--ARGVDpaELMSIVE 418

eirelarealaevRrllgdLR.paal<-*
+ + ++ + +e+R+++ +LR+p+a
CP001964_2 419 DALDNVDSSVREIRQIVYALRdPDAA 444

CP001964_2532: domain 1 of 1, from 182 to 250: score 60.4, E = 1.5e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HDs+g +L +++l ++++ + d+dp++are+++ +
CP001964_2 182 ERARLAREMHDSLGKTLHGVALAAQTLPSWV--DSDPDAAREHARLL 226

relarealaevRrllgdLR.paal<-*
++ a++a ae+R ll+++R ++ +
CP001964_2 227 ADGAHRAAAEARGLLTRMRaDQPD 250

CP001964_3285: domain 1 of 1, from 355 to 423: score 58.7, E = 4.6e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe....earea
ER+RIAR+LHD Q+L+a+ +q+e++r +++ ++ ++e+ +a
CP001964_3 355 ERTRIARDLHDLAIQQLFAAGMQVEALR-----ADPSGpvspEVSQA 396

ldeirelarealaevRrllgdLRpaal<-*
l+++ ++++ +++++R ++++L +++
CP001964_3 397 LEQVVAHVDAGIRQIRVIVRTLDDPGA 423

CP001964_3295: domain 1 of 1, from 48 to 113: score 42.8, E = 2.3e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA ELHD++g +L a+ lq+ +++ d +++e+r++ +++
CP001964_3 48 ERRRIADELHDVLGVRLVALLLQARRLA-----DHPDAEVRDTSRRL 89

relarealaevRrllgdLR.paal<-*
+l+++ ++evR l+g+L+ p+
CP001964_3 90 DHLVQQMMSEVRTLVGTLHaPTRA 113


Histogram of all scores:
score obs exp (one = represents 9 sequences)
----- --- ---
-14 2 0|=
-13 24 0|===
-12 44 41|====*
-11 93 337|=========== *
-10 286 782|================================ *
-9 526 888|==========================================================*
-8 470 684|===================================================== *
-7 520 430|===============================================*==========
-6 474 243|==========================*==========================
-5 476 130|==============*======================================
-4 242 68|=======*===================
-3 169 35|===*===============
-2 135 17|=*=============
-1 73 9|*========
0 47 4|*=====
1 28 2|*===
2 15 1|*=
3 15 0|==
4 9 0|=
5 4 0|=
6 1 0|=
7 2 0|=
8 1 0|=
9 1 0|=
10 2 0|=
11 1 0|=
12 1 0|=
> 13 17 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 4022.3516
P(chi-square) = 0

Total sequences searched: 3678

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 25K


Acknowledgements:

This research is funded by:

Developed by: