Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
264 projects found  

1 accessions found for Sideroxydans lithotrophicus ES-1  

Data for CP001965  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001965.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001965_1585 CDS_1605060-1602352 77.8 9.1e-23 1
CP001965_0621 CDS_636136-634949 61.7 5e-18 1
CP001965_2154 CDS_2202981-2201275 49.9 1.5e-14 1
CP001965_1807 CDS_1848192-1850276 44.7 5.2e-13 2
CP001965_1715 CDS_1736003-1737226 38.0 4.9e-11 1
CP001965_2201 CDS_2246508-2245051 32.4 2.2e-09 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001965_1585 1/1 701 768 .. 1 70 [] 77.8 9.1e-23
CP001965_0621 1/1 176 243 .. 1 70 [] 61.7 5e-18
CP001965_2154 1/1 370 435 .. 3 70 .] 49.9 1.5e-14
CP001965_1715 1/1 203 271 .. 1 70 [] 38.0 4.9e-11
CP001965_2201 1/1 287 352 .. 3 70 .] 32.4 2.2e-09
CP001965_1807 1/2 479 499 .. 1 21 [. 31.7 3.5e-09

Alignments of top-scoring domains:
CP001965_1585: domain 1 of 1, from 701 to 768: score 77.8, E = 9.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD++gQ L+++++ l++ r+++ + ++++ +++++i
CP001965_1 701 ERKRIARDLHDELGQILTVLRMDLSVMRMQF--GASNPALLDQIKNI 745

relarealaevRrllgdLRpaal<-*
++ +++ vR++++ LRp+al
CP001965_1 746 LSRVDSTIQVVRDVASKLRPGAL 768

CP001965_0621: domain 1 of 1, from 176 to 243: score 61.7, E = 5e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE HD++g L+aik+ l +++ +l +k + + +i
CP001965_0 176 ERLRIAREVHDEIGGLLTAIKMDLAWIKERL--PKSKKILTDKTSAI 220

relarealaevRrllgdLRpaal<-*
+ ++ +a++ +R+l++ LRp+ l
CP001965_0 221 ENMVGKAMTAARNLAHSLRPGYL 243

CP001965_2154: domain 1 of 1, from 370 to 435: score 49.9, E = 1.5e-14
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+RI RELHD +gQ+L++ + +el+ + l +k + ++++ i +
CP001965_2 370 ERIGRELHDDLGQQLTGTAFRAELLSQDL--KKQGNPEYQEAAKITT 414

larealaevRrllgdLRpaal<-*
+++ea++ +R+l+++L p +l
CP001965_2 415 MINEAIDKTRNLAQGLYPVEL 435

CP001965_1715: domain 1 of 1, from 203 to 271: score 38.0, E = 4.9e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER+ IA E+HDs++Q+L +++ + l+ ++ + ++e +a + +
CP001965_1 203 ERQSIANEIHDSLAQTLNYARMNTTLLSDAV--RNNNEvMATKYTRD 247

irelarealaevRrllgdLRpaal<-*
i e+++ +++ vR l++d+R + +
CP001965_1 248 IDEALEIGQKTVRTLITDFRSDMD 271

CP001965_2201: domain 1 of 1, from 287 to 352: score 32.4, E = 2.2e-09
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeire
+RI RELHD +gQ L++++ ++e++ + l d+ ee r + i
CP001965_2 287 QRIGRELHDDLGQLLTGVAFMSEVLFQKLK-DAGIEEMR-DASKITM 331

larealaevRrllgdLRpaal<-*
l++ea++ +R l+++L pa+l
CP001965_2 332 LVNEAMSRTRLLAHGLYPAEL 352

CP001965_1807: domain 1 of 2, from 479 to 499: score 31.7, E = 3.5e-09
*->ERaRIARELHDsvgQsLsaik<-*
ER+RIA ELHD++gQ+Lsaik
CP001965_1 479 ERKRIANELHDGIGQTLSAIK 499


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-15 1 0|=
-14 15 0|==
-13 69 0|=======
-12 106 33|===*=======
-11 177 273|================== *
-10 458 633|============================================== *
-9 539 719|====================================================== *
-8 435 554|============================================ *
-7 370 348|==================================*==
-6 271 197|===================*========
-5 244 105|==========*==============
-4 103 55|=====*=====
-3 73 28|==*=====
-2 43 14|=*===
-1 23 7|*==
0 19 3|*=
1 11 1|*=
2 3 0|=
3 5 0|=
4 1 0|=
5 3 0|=
6 0 0|
7 0 0|
8 1 0|=
9 1 0|=
10 0 0|
> 11 9 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 721.6312
P(chi-square) = 0

Total sequences searched: 2980

Whole sequence top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 6
Satisfying E cutoff: 6
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: