Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

2 accessions found for Tsukamurella paurometabola DSM 20162  

Data for CP001966  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001966.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001966_0631 CDS_667733-666495 92.7 4.9e-27 1
CP001966_2817 CDS_2982395-2981124 82.3 5.8e-24 1
CP001966_1948 CDS_2080354-2079260 77.0 2.2e-22 1
CP001966_3458 CDS_3644770-3645879 74.4 1.2e-21 1
CP001966_3433 CDS_3620658-3619528 64.6 9.6e-19 1
CP001966_0950 CDS_994087-995340 62.9 3.2e-18 2
CP001966_2365 CDS_2511879-2510758 61.3 9.2e-18 1
CP001966_4062 CDS_4276770-4277915 56.7 2e-16 1
CP001966_1834 CDS_1963042-1961924 55.8 3.9e-16 1
CP001966_1385 CDS_1478925-1477765 54.7 8.2e-16 1
CP001966_0987 CDS_1032717-1033841 53.5 1.8e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001966_0631 1/1 204 271 .. 1 70 [] 92.7 4.9e-27
CP001966_2817 1/1 217 284 .. 1 70 [] 82.3 5.8e-24
CP001966_1948 1/1 174 242 .. 1 70 [] 77.0 2.2e-22
CP001966_3458 1/1 187 255 .. 1 70 [] 74.4 1.2e-21
CP001966_3433 1/1 176 241 .. 1 70 [] 64.6 9.6e-19
CP001966_0950 2/2 232 297 .. 1 70 [] 62.6 3.7e-18
CP001966_2365 1/1 176 242 .. 1 70 [] 61.3 9.2e-18
CP001966_4062 1/1 186 252 .. 1 70 [] 56.7 2e-16
CP001966_1834 1/1 181 244 .. 1 70 [] 55.8 3.9e-16
CP001966_1385 1/1 186 255 .. 1 70 [] 54.7 8.2e-16
CP001966_0987 1/1 173 236 .. 1 70 [] 53.5 1.8e-15

Alignments of top-scoring domains:
CP001966_0631: domain 1 of 1, from 204 to 271: score 92.7, E = 4.9e-27
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARE+HD+v++sL++i +q+++ar++ d+dp++a +al++i
CP001966_0 204 ERSRLAREMHDVVAHSLAVIVMQSQGARYIQ--DSDPARASAALETI 248

relarealaevRrllgdLRpaal<-*
+ ar+ala+vR llg+LR+++
CP001966_0 249 GDVARDALADVRTLLGQLRTGTS 271

CP001966_2817: domain 1 of 1, from 217 to 284: score 82.3, E = 5.8e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD v++++s++ +q+++a++++ ++ e+ar+++d i
CP001966_2 217 ERTRIARDLHDIVAHRMSLVVVQAQTAQYRV--PDVSERARAEFDGI 261

relarealaevRrllgdLRpaal<-*
+ areal+evR llg+LR ++
CP001966_2 262 AVSAREALNEVRSLLGVLRLDDA 284

CP001966_1948: domain 1 of 1, from 174 to 242: score 77.0, E = 2.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR+LHD+++++Ls++ +qlela +ll+ + pe ar+a++++
CP001966_1 174 ERARIARDLHDVLAHTLSGAGMQLELADALLE-AGRPEDARTAVQRA 219

relarealaevRrllgdLRpaal<-*
r+++ + +e+R+++++LR+++
CP001966_1 220 RGAIAGGVTEARDAVHALREDII 242

CP001966_3458: domain 1 of 1, from 187 to 255: score 74.4, E = 1.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER R AR+LHD+vg ++sa+++++ela++l+ ++ + ++a++++de
CP001966_3 187 ERLRFARDLHDVVGRGFSAVAVKSELAATLA--RAGATdRAAAEMDE 231

irelarealaevRrllgdLRpaal<-*
++ la ++++e+R l++++R+ +l
CP001966_3 232 VKSLAVTSMEEMRSLVRGYRDVDL 255

CP001966_3433: domain 1 of 1, from 176 to 241: score 64.6, E = 9.6e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARELHD v+++++ai++ +++ar+++ +++ + ++ ld +
CP001966_3 176 ERAALARELHDLVAHHMAAIIMRVGVARTRT--ADA--QSKAVLDDV 218

relarealaevRrllgdLRpaal<-*
+e+a++al +R ll+++R+++
CP001966_3 219 HETASQALGNIRSLLTAIRTDQV 241

CP001966_0950: domain 2 of 2, from 232 to 297: score 62.6, E = 3.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q L ++++ql+++++ + d++ +r +++++
CP001966_0 232 ERRRIERDLHDGPQQDLVSLSMQLGMLQQSV--DDE--SVRGEVAQA 274

relarealaevRrllgdLRpaal<-*
++ +++ala +R+++++ +p++l
CP001966_0 275 QAQVERALAGLRDTVRGVHPQVL 297

CP001966_2365: domain 1 of 1, from 176 to 242: score 61.3, E = 9.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa +ARE+HD+v+++ s+i++ +++++ + +++ +are ++ +
CP001966_2 176 ERAQLAREMHDVVSHQVSLIAVEAGALQVTA--TDE--AARESARSV 218

relarealaevRrllgdLR.paal<-*
r+la +l+e+R+++g+LR +++
CP001966_2 219 RRLAVSTLDELRHMVGVLRaSGTE 242

CP001966_4062: domain 1 of 1, from 186 to 252: score 56.7, E = 2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD v Q+++a+ l+l++ar ++ +++ ++re+ld++
CP001966_4 186 ERERIGRDLHDHVIQRIFAAGLGLQVARSAA--ADE--PVRERLDAA 228

relarealaevRrllgdLR.paal<-*
+ +++++a++R ++ +L +++++
CP001966_4 229 IGELDRTIADIRSTIFELSdHGTE 252

CP001966_1834: domain 1 of 1, from 181 to 244: score 55.8, E = 3.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHD+v+ +Lsa+++ +++a+ +++ l++i
CP001966_1 181 ERRRLARELHDTVAGHLSAVAILADAAQ-----RSP--GDPGVLKTI 220

relarealaevRrllgdLR.paal<-*
r + al+e+R ++ L +p++
CP001966_1 221 RSGSLAALEEMRSTINLLTsPDDA 244

CP001966_1385: domain 1 of 1, from 186 to 255: score 54.7, E = 8.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
Ra IA E HD+v++sL+++ l + +arr+l ++d+++ ea eal+
CP001966_1 186 DRATIAGEVHDVVAHSLAVVLLNVTAARRAL--AADDDraEAVEALR 230

eirelarealaevRrllgdLRpaal<-*
+++ +r a++++Rr++ LR+a+
CP001966_1 231 DAETQGRAAMNDIRRTIELLRTAGP 255

CP001966_0987: domain 1 of 1, from 173 to 236: score 53.5, E = 1.8e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +ARELHD++++ ++i + +++ + + + +l +i
CP001966_0 173 ERTAMARELHDVIAHEVTGIVVLAQAGIA----ANG--DTDGTLSRI 213

relarealaevRrllgdLRpaal<-*
++ + +ala++R+++ +LR++++
CP001966_0 214 ERSGARALADIRAMVDTLREPGD 236


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 7 0|=
-13 42 0|====
-12 71 46|====*==
-11 144 381|============== *
-10 399 884|===================================== *
-9 644 1003|==========================================================*
-8 646 773|==========================================================*
-7 637 486|============================================*=============
-6 448 275|========================*================
-5 457 147|=============*============================
-4 271 77|======*==================
-3 153 39|===*==========
-2 88 20|=*======
-1 42 10|*===
0 37 5|*===
1 27 2|*==
2 11 1|*
3 7 0|=
4 6 0|=
5 3 0|=
> 6 17 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 2708.1064
P(chi-square) = 0

Total sequences searched: 4157

Whole sequence top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 11
Satisfying E cutoff: 11
Total memory: 24K


Acknowledgements:

This research is funded by:

Developed by: