Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Propionibacterium acnes SK137  

Data for CP001977  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001977.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001977_0068 CDS_71659-70289 88.1 6.4e-26 1
CP001977_0959 CDS_1010435-1011784 79.0 3.2e-23 1
CP001977_2026 CDS_2154448-2155647 75.1 4.4e-22 1
CP001977_1105 CDS_1171408-1172628 71.8 4.3e-21 1
CP001977_0440 CDS_476081-477217 67.8 6.2e-20 1
CP001977_0329 CDS_366841-365609 55.2 3.3e-16 1
CP001977_0898 CDS_947042-948241 55.1 3.5e-16 1
CP001977_0976 CDS_1029247-1028240 49.9 1.2e-14 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001977_0068 1/1 254 321 .. 1 70 [] 88.1 6.4e-26
CP001977_0959 1/1 241 308 .. 1 70 [] 79.0 3.2e-23
CP001977_2026 1/1 185 260 .. 1 70 [] 75.1 4.4e-22
CP001977_1105 1/1 195 260 .. 1 70 [] 71.8 4.3e-21
CP001977_0440 1/1 191 258 .. 1 70 [] 67.8 6.2e-20
CP001977_0329 1/1 214 280 .. 1 70 [] 55.2 3.3e-16
CP001977_0898 1/1 201 267 .. 1 70 [] 55.1 3.5e-16
CP001977_0976 1/1 131 196 .. 1 70 [] 49.9 1.2e-14

Alignments of top-scoring domains:
CP001977_0068: domain 1 of 1, from 254 to 321: score 88.1, E = 6.4e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+ IARELHD v++sLs++++q+e+ ++l+ +k pe+a e l++i
CP001977_0 254 TRNEIARELHDIVAHSLSVMIVQAEGGKALA--TKKPEKAPEVLETI 298

relarealaevRrllgdLRpaal<-*
+e++real e+Rr++g+LR +++
CP001977_0 299 AETGREALLEMRRIVGVLRQDTD 321

CP001977_0959: domain 1 of 1, from 241 to 308: score 79.0, E = 3.2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HDs +++ s++ +++ +arr++ d dp+ areal+++
CP001977_0 241 ERLRIAREMHDSMAHHVSVVGIHAAGARRAF--DVDPDLAREALATV 285

relarealaevRrllgdLRpaal<-*
+ +rea +e+R llg LR +++
CP001977_0 286 EVESREAVTEMRSLLGSLRAGDE 308

CP001977_2026: domain 1 of 1, from 185 to 260: score 75.1, E = 4.4e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrllds..dkdpe....ear
ERa IAR++HD v++sLs+i +q+++ ++l++++++ d e++ ++
CP001977_2 185 ERAKIARDIHDIVAHSLSVIVVQADGGAYLAHHeeAGDIEtrlsASG 231

ealdeirelarealaevRrllgdLRpaal<-*
+ald+i+++ar+al+e+Rrl+g+LR+ +
CP001977_2 232 QALDTIATTARHALDETRRLVGVLRDNDA 260

CP001977_1105: domain 1 of 1, from 195 to 260: score 71.8, E = 4.3e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v+QsLs+i l l++++r + +++ +a e+++ +
CP001977_1 195 ERARLAREIHDTVAQSLSSIGLLLSAVERTA--PDH--PAIEQIRLA 237

relarealaevRrllgdLRpaal<-*
+ ++++al+e+R l+ +L p++
CP001977_1 238 HLASSDALSETRGLIAELAPPTV 260

CP001977_0440: domain 1 of 1, from 191 to 258: score 67.8, E = 6.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ A + HD +gQ+L++++++++la+rl+ +dp++ar+++ e+
CP001977_0 191 EREQVASDVHDLLGQTLTVMAMKAQLAERLI--GTDPDAARAQAVEL 235

relarealaevRrllgdLRpaal<-*
++l r+ala+vR+l++d+ +++
CP001977_0 236 HGLTRRALAQVRELVSDMAHMGV 258

CP001977_0329: domain 1 of 1, from 214 to 280: score 55.2, E = 3.3e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+E+HD +g++Ls+++lq+++++++l +++p+ ++ a++e+
CP001977_0 214 ERERIAQEIHDQLGHRLSLLSLQSGALETQL--RDNPDVVK-AAHEV 257

relarealaevRrllgdLRpaal<-*
++ a a +++ ll++L ++
CP001977_0 258 QAGAAAAVNDLHSLLSVLTESRV 280

CP001977_0898: domain 1 of 1, from 201 to 267: score 55.1, E = 3.5e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI RELHD+v Q L+a l l +a+ l+ +d++ea +a++ +
CP001977_0 201 ERRRIERELHDGVQQYLTATQLALATAQ-LA--STDNPEALAAIAIA 244

relarealaevRrllgdLRpaal<-*
+e +a a +R ++++++p +l
CP001977_0 245 QENTGRAVAALRTTIRGIHPRVL 267

CP001977_0976: domain 1 of 1, from 131 to 196: score 49.9, E = 1.2e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +A ELHD+v+ L++i++ ++ +r +++e + +a + i
CP001977_0 131 ERQQLAAELHDVVAKDLTVITMLAGSLRL----NTANEDVITASKSI 173

relarealaevRrllgdLRpaal<-*
+ ++r al+++ rll +LR l
CP001977_0 174 ENTSRAALDDLQRLLLVLRNRNL 196


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 10 0|==
-13 59 0|=========
-12 84 26|===*========
-11 152 215|====================== *
-10 324 500|=============================================== *
-9 393 567|========================================================= *
-8 341 437|================================================= *
-7 323 275|=======================================*=======
-6 207 155|======================*=======
-5 194 83|===========*================
-4 108 43|======*=========
-3 53 22|===*====
-2 34 11|=*===
-1 27 5|*===
0 14 2|*=
1 12 1|*=
2 2 0|=
3 2 0|=
4 3 0|=
> 5 10 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 711.9949
P(chi-square) = 0

Total sequences searched: 2352

Whole sequence top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 8
Satisfying E cutoff: 8
Total memory: 23K


Acknowledgements:

This research is funded by:

Developed by: