Crenarchaeota Euryarchaeota Nanoarchaeota
Other Archaea
Classification of phyla is from NCBI page
Search:
54 projects found  

1 accessions found for Methanohalophilus mahii DSM 5219  

Data for CP001994  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001994.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001994_0486 CDS_515986-513719 151.0 4.5e-43 1
CP001994_1119 CDS_1166808-1164625 141.2 2.6e-40 1
CP001994_0977 CDS_1020485-1021597 123.6 2.8e-35 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001994_0486 1/1 553 639 .. 1 94 [] 151.0 4.5e-43
CP001994_1119 1/1 532 616 .. 1 94 [] 141.2 2.6e-40
CP001994_0977 1/1 182 268 .. 1 94 [] 123.6 2.8e-35

Alignments of top-scoring domains:
CP001994_0486: domain 1 of 1, from 553 to 639: score 151.0, E = 4.5e-43
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQvIS LL L+++kfkd +v l+a++ s++RV++
CP001994_0 553 EIHHRIKNNLQVISTLLYLESEKFKDDDV-----LDAFNNSRDRVRT 594

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
mAl+HE+LY+s+d++++dfs+Y ++L+++L qsy ++++ +++k +
CP001994_0 595 MALVHEKLYQSKDMESIDFSDYSKNLINYLSQSYVLEKSEVDIK--I 639

CP001994_1119: domain 1 of 1, from 532 to 616: score 141.2, E = 2.6e-40
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQv+S+LL L++ +fk+ ev ea++ s+nRV+S
CP001994_1 532 EIHHRIKNNLQVVSGLLYLESLNFKSDEV-----MEAFKQSENRVRS 573

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliHE+LY se+l ++++s+Y+e L+e+L++sy+v+ d i+ +
CP001994_1 574 IALIHEKLYHSENLTSLNLSDYVEDLVEHLINSYNVDEDTIK----I 616

CP001994_0977: domain 1 of 1, from 182 to 268: score 123.6, E = 2.8e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHR+KNNLQv+S+LL L++ + +v ea++ s+nRV+S
CP001994_0 182 EIHHRIKNNLQVVSGLLYLESTNYNPNKV-----VEAFKQSENRVRS 223

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+AliHE+LY+s d +t+df +Y+++L e+L++sy ++ +++ +k +
CP001994_0 224 IALIHEKLYQSCDCKTLDFLDYVNELMEYLMHSYDLDTNKVIVK--I 268


Histogram of all scores:
score obs exp (one = represents 8 sequences)
----- --- ---
-15 3 0|=
-14 3 0|=
-13 16 12|=*
-12 81 130|=========== *
-11 465 363|=============================================*=============
-10 426 470|====================================================== *
-9 365 397|============================================== *
-8 276 266|=================================*=
-7 130 158|================= *
-6 129 88|==========*======
-5 37 47|=====*
-4 22 25|===*
-3 13 13|=*
-2 9 6|*=
-1 3 3|*
0 2 1|*
1 0 0|
2 3 0|=
> 3 4 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 82.6568
P(chi-square) = 4.511e-13

Total sequences searched: 1987

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: