Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
25 projects found  

1 accessions found for   

Data for CP001998  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP001998.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001998_3110 CDS_3737493-3735382 49.1 2.6e-14 1
CP001998_0414 CDS_506869-509130 47.7 6.8e-14 2
CP001998_0986 CDS_1265442-1263286 41.5 4.7e-12 1
CP001998_0493 CDS_631260-633449 33.2 1.3e-09 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001998_3110 1/1 506 573 .. 1 70 [] 49.1 2.6e-14
CP001998_0414 1/2 511 562 .. 1 54 [. 42.4 2.5e-12
CP001998_0986 1/1 487 510 .. 1 24 [. 41.5 4.7e-12

Alignments of top-scoring domains:
CP001998_3110: domain 1 of 1, from 506 to 573: score 49.1, E = 2.6e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA+ELHD++ QsL+a+ + l + + +l +++ e+are+++ +
CP001998_3 506 ERRRIAQELHDTLEQSLAALGMFLKVSQNQL--KDASEKARETVAKA 550

relarealaevRrllgdLRpaal<-*
++ r + ++ R+++ +LR+ ++
CP001998_3 551 IGMQRSCAEQSRAAIVELRDHQE 573

CP001998_0414: domain 1 of 2, from 511 to 562: score 42.4, E = 2.5e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD + Q+L+++++ql +a+rl+ +++++ +r+ +
CP001998_0 511 ERQRIARELHDNLEQGLAGMAIQLRGALRLF--ERHAANLRASTSKA 555

relarea<-*
el++++
CP001998_0 556 LELVQDG 562

CP001998_0986: domain 1 of 1, from 487 to 510: score 41.5, E = 4.7e-12
*->ERaRIARELHDsvgQsLsaiklql<-*
ER+RIARELHD+++QsL ++ +ql
CP001998_0 487 ERQRIARELHDTLAQSLVGMGIQL 510


Histogram of all scores:
score obs exp (one = represents 11 sequences)
----- --- ---
-14 15 0|==
-13 50 0|=====
-12 107 34|===*======
-11 169 285|================ *
-10 490 663|============================================= *
-9 600 753|======================================================= *
-8 506 580|============================================== *
-7 374 365|=================================*
-6 301 206|==================*=========
-5 239 110|=========*============
-4 118 57|=====*=====
-3 56 29|==*===
-2 31 15|=*=
-1 26 7|*==
0 12 3|*=
1 7 1|*
2 3 1|*
3 2 0|=
4 6 0|=
5 0 0|
6 1 0|=
> 7 7 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 620.2244
P(chi-square) = 0

Total sequences searched: 3120

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: