Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
32 projects found  

1 accessions found for Arcobacter nitrofigilis DSM 7299  

Data for CP001999  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP001999.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP001999_0326 CDS_312456-310585 77.8 4.5e-22 1
CP001999_0106 CDS_97473-99323 73.6 7.2e-21 1
CP001999_2066 CDS_2074712-2073276 67.0 5.3e-19 1
CP001999_1502 CDS_1512972-1514759 41.6 8.8e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP001999_0326 1/1 427 513 .. 1 94 [] 77.8 4.5e-22
CP001999_0106 1/1 427 513 .. 1 94 [] 73.6 7.2e-21
CP001999_2066 1/1 282 368 .. 1 94 [] 67.0 5.3e-19
CP001999_1502 1/1 402 482 .. 1 94 [] 41.6 8.8e-12

Alignments of top-scoring domains:
CP001999_0326: domain 1 of 1, from 427 to 513: score 77.8, E = 4.5e-22
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR+KNNLQ+IS+LL + +k ++e+ +++L E + R++S
CP001999_0 427 ELSHRIKNNLQIISALLYMDKDKLENEKD-----KDILDENIKRIKS 468

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++++E ++e+ +++++ Y+ek+++++++sy+ ++ +L+ +
CP001999_0 469 ISILYENFLETENPNKIELKKYIEKIISEIKNSYSSLGIQYELN--I 513

CP001999_0106: domain 1 of 1, from 427 to 513: score 73.6, E = 7.2e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HR+KNNLQ+IS+LL++ +k ++e+ +++L E + R++S
CP001999_0 427 ELSHRIKNNLQIISALLSMDKDKLENEKD-----KDILDENIKRIKS 468

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+++++E + ++ +++++ Y+ek+++++++sy+ ++ +L+ +
CP001999_0 469 ISILYENFLEIKNPNKIELKKYIEKIISEIKNSYSSLDIQYDLD--I 513

CP001999_2066: domain 1 of 1, from 282 to 368: score 67.0, E = 5.3e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRVKNN+Q I+SL L d+++ +e L + ++ + +
CP001999_2 282 ELHHRVKNNMQFITSLYALKLNDNNDKHI-----QEKLYDVERKIHA 323

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
m+++H++LY ++l ++d +eY+ek++ n+++s++ +++ +L+ +
CP001999_2 324 MSIVHQMLYNQKNLVKIDAKEYFEKVLQNIKDSFEIENITCELD--I 368

CP001999_1502: domain 1 of 1, from 402 to 482: score 41.6, E = 8.8e-12
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E++HR+KNN I S L L+ k + e+ + E ++R+ S
CP001999_1 402 EMNHRIKNNFHFIMSVLHLENKKKQYSET-------VYLELISRISS 441

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+ HE+LY + d ++v +seYl+ +t+++++ y + Lk +
CP001999_1 442 FSSMHEQLYLTND-KNVSISEYLSAITNDIKNIYVNFQG---LK--I 482


Histogram of all scores:
score obs exp (one = represents 12 sequences)
----- --- ---
-15 2 0|=
-14 7 0|=
-13 24 19|=*
-12 107 205|========= *
-11 563 571|===============================================*
-10 513 739|=========================================== *
-9 679 624|===================================================*=====
-8 477 419|==================================*=====
-7 293 248|====================*====
-6 249 138|===========*=========
-5 84 74|======*
-4 54 39|===*=
-3 38 20|=*==
-2 12 10|*
-1 14 5|*=
0 3 2|*
1 1 1|*
> 2 6 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 259.2499
P(chi-square) = 0

Total sequences searched: 3126

Whole sequence top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 4
Satisfying E cutoff: 4
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: