Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for Amycolatopsis mediterranei U32  

Data for CP002000  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002000.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002000_6777 CDS_7592721-7595075 113.3 9.6e-33 2
CP002000_4493 CDS_5002300-5001230 90.1 6.6e-26 1
CP002000_9121 CDS_10114428-10115585 89.9 7.7e-26 1
CP002000_0111 CDS_118845-119924 88.7 1.7e-25 1
CP002000_7769 CDS_8677562-8678629 87.6 3.7e-25 1
CP002000_0942 CDS_1011009-1009903 87.5 3.9e-25 1
CP002000_2809 CDS_3031845-3033071 86.2 9.2e-25 1
CP002000_3517 CDS_3856603-3855119 83.7 5.1e-24 1
CP002000_3511 CDS_3847903-3849039 82.8 9e-24 1
CP002000_6396 CDS_7178210-7179541 82.6 1.1e-23 1
CP002000_8096 CDS_9048679-9049785 81.4 2.5e-23 1
CP002000_1080 CDS_1148865-1147723 80.5 4.3e-23 1
CP002000_2772 CDS_2994832-2993702 79.3 9.7e-23 1
CP002000_6501 CDS_7287599-7286397 76.9 5.2e-22 1
CP002000_5423 CDS_6093374-6094543 76.1 8.5e-22 1
CP002000_8797 CDS_9786690-9787844 74.2 3.2e-21 1
CP002000_5439 CDS_6106268-6107497 73.4 5.5e-21 1
CP002000_2739 CDS_2959440-2958241 72.9 7.8e-21 1
CP002000_6106 CDS_6852502-6851369 72.0 1.4e-20 1
CP002000_0042 CDS_45307-47130 71.9 1.5e-20 1
CP002000_5338 CDS_5995466-5994288 71.3 2.3e-20 1
CP002000_8326 CDS_9292938-9294095 71.3 2.3e-20 1
CP002000_3651 CDS_4022463-4021342 69.1 1e-19 1
CP002000_6781 CDS_7599621-7598464 68.1 1.9e-19 1
CP002000_1248 CDS_1338200-1337067 67.8 2.4e-19 1
CP002000_2381 CDS_2573457-2572363 66.8 4.7e-19 1
CP002000_3977 CDS_4400327-4399077 66.2 7.2e-19 1
CP002000_1375 CDS_1480020-1478821 65.7 1e-18 1
CP002000_0962 CDS_1025650-1026750 65.5 1.2e-18 1
CP002000_9133 CDS_10126130-10127929 65.0 1.7e-18 1
CP002000_6410 CDS_7191295-7192542 63.8 3.8e-18 1
CP002000_2900 CDS_3139387-3138206 62.8 7.4e-18 2
CP002000_7124 CDS_7973826-7974959 61.6 1.7e-17 1
CP002000_0465 CDS_473191-474423 59.1 8.9e-17 2
CP002000_1523 CDS_1649747-1648212 57.1 3.4e-16 1
CP002000_6257 CDS_7023016-7024251 56.9 3.9e-16 1
CP002000_4323 CDS_4792287-4793789 56.5 5.2e-16 1
CP002000_0164 CDS_178332-179261 55.3 1.2e-15 1
CP002000_6100 CDS_6846579-6847739 53.2 5.1e-15 1
CP002000_5405 CDS_6074231-6072480 50.6 2.8e-14 1
CP002000_5099 CDS_5720446-5719025 49.7 5.4e-14 2
CP002000_1265 CDS_1357191-1358765 47.6 2.2e-13 1
CP002000_3117 CDS_3398413-3399477 47.4 2.5e-13 1
CP002000_2065 CDS_2230274-2228973 47.4 2.5e-13 1
CP002000_1452 CDS_1561704-1562813 46.8 3.9e-13 2
CP002000_5501 CDS_6180474-6178882 43.7 3.1e-12 1
CP002000_4765 CDS_5340068-5340745 41.6 1.3e-11 1
CP002000_5896 CDS_6625725-6624736 35.4 8.8e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002000_4493 1/1 178 245 .. 1 70 [] 90.1 6.6e-26
CP002000_9121 1/1 173 240 .. 1 70 [] 89.9 7.7e-26
CP002000_0111 1/1 164 231 .. 1 70 [] 88.7 1.7e-25
CP002000_7769 1/1 168 233 .. 1 70 [] 87.6 3.7e-25
CP002000_0942 1/1 168 235 .. 1 70 [] 87.5 3.9e-25
CP002000_2809 1/1 210 278 .. 1 70 [] 86.2 9.2e-25
CP002000_3517 1/1 158 225 .. 1 70 [] 83.7 5.1e-24
CP002000_3511 1/1 177 244 .. 1 70 [] 82.8 9e-24
CP002000_6396 1/1 229 296 .. 1 70 [] 82.6 1.1e-23
CP002000_8096 1/1 170 237 .. 1 70 [] 81.4 2.5e-23
CP002000_1080 1/1 183 249 .. 1 70 [] 80.5 4.3e-23
CP002000_2772 1/1 182 247 .. 1 70 [] 79.3 9.7e-23
CP002000_6501 1/1 199 268 .. 1 70 [] 76.9 5.2e-22
CP002000_5423 1/1 176 243 .. 1 70 [] 76.1 8.5e-22
CP002000_8797 1/1 188 255 .. 1 70 [] 74.2 3.2e-21
CP002000_5439 1/1 197 264 .. 1 70 [] 73.4 5.5e-21
CP002000_2739 1/1 202 269 .. 1 70 [] 72.9 7.8e-21
CP002000_6106 1/1 176 243 .. 1 70 [] 72.0 1.4e-20
CP002000_0042 1/1 402 469 .. 1 70 [] 71.9 1.5e-20
CP002000_6777 2/2 578 645 .. 1 70 [] 71.4 2.2e-20
CP002000_5338 1/1 198 265 .. 1 70 [] 71.3 2.3e-20
CP002000_8326 1/1 192 259 .. 1 70 [] 71.3 2.3e-20
CP002000_3651 1/1 179 249 .. 1 70 [] 69.1 1e-19
CP002000_6781 1/1 185 252 .. 1 70 [] 68.1 1.9e-19
CP002000_1248 1/1 187 254 .. 1 70 [] 67.8 2.4e-19
CP002000_2381 1/1 171 240 .. 1 70 [] 66.8 4.7e-19
CP002000_3977 1/1 224 291 .. 1 70 [] 66.2 7.2e-19
CP002000_1375 1/1 209 276 .. 1 70 [] 65.7 1e-18
CP002000_0962 1/1 171 238 .. 1 70 [] 65.5 1.2e-18
CP002000_9133 1/1 385 453 .. 1 70 [] 65.0 1.7e-18
CP002000_6410 1/1 203 266 .. 1 66 [. 63.8 3.8e-18
CP002000_2900 1/2 195 261 .. 1 70 [] 62.0 1.3e-17
CP002000_7124 1/1 176 244 .. 1 70 [] 61.6 1.7e-17
CP002000_0465 2/2 220 287 .. 1 70 [] 58.5 1.4e-16
CP002000_1523 1/1 321 389 .. 1 70 [] 57.1 3.4e-16
CP002000_6257 1/1 193 258 .. 1 70 [] 56.9 3.9e-16
CP002000_4323 1/1 294 360 .. 1 70 [] 56.5 5.2e-16
CP002000_0164 1/1 109 178 .. 1 70 [] 55.3 1.2e-15
CP002000_6100 1/1 175 244 .. 1 70 [] 53.2 5.1e-15
CP002000_5405 1/1 389 454 .. 1 70 [] 50.6 2.8e-14
CP002000_5099 2/2 272 336 .. 1 70 [] 48.4 1.3e-13
CP002000_1265 1/1 182 248 .. 1 70 [] 47.6 2.2e-13
CP002000_3117 1/1 153 221 .. 1 70 [] 47.4 2.5e-13
CP002000_2065 1/1 247 313 .. 3 70 .] 47.4 2.5e-13
CP002000_5501 1/1 339 405 .. 1 70 [] 43.7 3.1e-12
CP002000_1452 2/2 176 244 .. 1 70 [] 42.7 6e-12
CP002000_6777 1/2 204 271 .. 1 70 [] 41.9 1e-11
CP002000_4765 1/1 26 86 .. 8 70 .] 41.6 1.3e-11
CP002000_5896 1/1 141 199 .. 9 70 .] 35.4 8.8e-10

Alignments of top-scoring domains:
CP002000_4493: domain 1 of 1, from 178 to 245: score 90.1, E = 6.6e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIAR+LHD +g+sL+ai++++ larrl+ ++++++a e+++++
CP002000_4 178 ERTRIARDLHDLLGHSLTAITVKSTLARRLV--TAEAARAGEEMAAV 222

relarealaevRrllgdLRpaal<-*
++lar+al++vR++++++R+ +l
CP002000_4 223 ETLARQALTDVRAAVSGYREVTL 245

CP002000_9121: domain 1 of 1, from 173 to 240: score 89.9, E = 7.7e-26
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD+v+++ s++ +q+++a +++ +++p+ a++al++i
CP002000_9 173 ERGRIARELHDVVAHAVSVMVVQADGASYAI--QSNPDLAQRALQTI 217

relarealaevRrllgdLRpaal<-*
e++r al e+Rrll +LR ++
CP002000_9 218 SETGRGALGELRRLLDVLRSDDA 240

CP002000_0111: domain 1 of 1, from 164 to 231: score 88.7, E = 1.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE HD+v++sL++i++q+++a++++ d+ pe+a+eal +i
CP002000_0 164 ERLRIAREVHDVVAHSLAMINVQAGVAAHVA--DRRPEQAKEALLNI 208

relarealaevRrllgdLRpaal<-*
++++ al+++R++l +LR +++
CP002000_0 209 KAASASALKDLRATLAVLRSGED 231

CP002000_7769: domain 1 of 1, from 168 to 233: score 87.6, E = 3.7e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHD++g++L++i++q+++a++ ++dp++a+eal +i
CP002000_7 168 ERLRIARELHDVLGHHLALINVQAGAALH----RRDPGQAEEALGAI 210

relarealaevRrllgdLRpaal<-*
++++++al+e+R +lg LR ++
CP002000_7 211 KDASKTALQELRTTLGMLRQTGG 233

CP002000_0942: domain 1 of 1, from 168 to 235: score 87.5, E = 3.9e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE+HD+v++s+s+i++++ + +++ + p++ar+al+ i
CP002000_0 168 ERLRIAREMHDVVAHSMSLIAVKAAVGNHVA--LEQPDQARDALRVI 212

relarealaevRrllgdLRpaal<-*
++++re+lae+Rr+lg+LR+++
CP002000_0 213 EDTSRETLAELRRMLGVLRDGTG 235

CP002000_2809: domain 1 of 1, from 210 to 278: score 86.2, E = 9.2e-25
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARELHDsvg++Ls++++q+++arr l ++dp+ ++al +i
CP002000_2 210 ERNRLARELHDSVGHALSVVTVQAGAARRTL--RTDPDFTERALGAI 254

relarealaevRrllgdLR.paal<-*
+e ar+al+++ ++lg LR+++a
CP002000_2 255 EESARTALDDLDHVLGLLReETAG 278

CP002000_3517: domain 1 of 1, from 158 to 225: score 83.7, E = 5.1e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELH +v++++s+i+lq++lar+++ d+dp+ ar+a+++i
CP002000_3 158 ERVRIARELHAVVAHHMSVISLQAGLARYVF--DSDPQTARTAVATI 202

relarealaevRrllgdLRpaal<-*
+++real+e+Rrll +LR +++
CP002000_3 203 DGTSREALQEMRRLLDVLRLDDD 225

CP002000_3511: domain 1 of 1, from 177 to 244: score 82.8, E = 9e-24
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARE HD+v++s+s+i++q++ +l d+ p++ar+al +i
CP002000_3 177 ERMRIAREVHDVVAHSMSVITVQAGFGDLVL--DDQPAQARAALGAI 221

relarealaevRrllgdLRpaal<-*
++++real+e+Rrllg LR+++
CP002000_3 222 ATTGREALTEMRRLLGMLRDDGP 244

CP002000_6396: domain 1 of 1, from 229 to 296: score 82.6, E = 1.1e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R ARE+HD vg++Ls+i+ +++ ++++ d +pe+ +eal+ +
CP002000_6 229 ERVRVAREMHDIVGHNLSVIITLADGGAYAA--DVAPERSKEALRLV 273

relarealaevRrllgdLRpaal<-*
+++r+al e+Rr+lg+LR+ ++
CP002000_6 274 GDAGRQALGELRRMLGVLREKGE 296

CP002000_8096: domain 1 of 1, from 170 to 237: score 81.4, E = 2.5e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++++s+s+i l +e+a+ + ++dpe+++++ld+i
CP002000_8 170 ERTRIARELHDVLAHSMSVIVLNAEGAKLAR--HRDPEAVDRTLDTI 214

relarealaevRrllgdLRpaal<-*
+++r+al e+Rrll +L+ ++
CP002000_8 215 VHTGRDALGELRRLLEVLHAGQA 237

CP002000_1080: domain 1 of 1, from 183 to 249: score 80.5, E = 4.3e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD+v ++ +a+ +q+e+ar+l+ ++p++++++l++i
CP002000_1 183 ERTRIARELHDVVTHHVTAMVVQAEAARYLT---AAPDRLDRTLTAI 226

relarealaevRrllgdLRpaal<-*
+++r+a++++R+ll L p+
CP002000_1 227 TGTGRRAITDLRHLLDLLNPDHG 249

CP002000_2772: domain 1 of 1, from 182 to 247: score 79.3, E = 9.7e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaR+ARE+HD+v++++++i++q++++++++ ++d a e+++ i
CP002000_2 182 ERARLAREMHDVVSHQITLIAMQAGALQAQT--TDD--HALETAQVI 224

relarealaevRrllgdLRpaal<-*
r+l++++l+e+R l+++LR + +
CP002000_2 225 RTLSKRTLEELRSLVSVLRAGSD 247

CP002000_6501: domain 1 of 1, from 199 to 268: score 76.9, E = 5.2e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+AR+LHD +g+sL+ i+++++larr+l+s+ d ++a e+++e+
CP002000_6 199 ERERLARDLHDLLGHSLTTITVKAGLARRVLESAGDIPRAVEEIREV 245

relarealaevRrllgdLRpaal<-*
+ l r al++vR+++++ R+ l
CP002000_6 246 ENLTRSALSDVRATVSANREVSL 268

CP002000_5423: domain 1 of 1, from 176 to 243: score 76.1, E = 8.5e-22
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIARELHDsv++s+ i++ +++a+r++ d+ p++ar+al i
CP002000_5 176 ERLRIARELHDSVAHSMGIITVLSGAAARVV--DTKPQQARQALIGI 220

relarealaevRrllgdLRpaal<-*
++++r++l e+ r+lg+LR a+
CP002000_5 221 ETTSRQTLLELQRMLGALRRAEP 243

CP002000_8797: domain 1 of 1, from 188 to 255: score 74.2, E = 3.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ IAR+LHD+++++ sai +++++ar l ++ +e+ar+ l ++
CP002000_8 188 ERTTIARDLHDVISHHVSAIGVHAGAARLGL--PDGAEPARKSLGAV 232

relarealaevRrllgdLRpaal<-*
+ ++r a+a++Rrll L+ ++
CP002000_8 233 ESASRSAMADLRRLLDLLHAETD 255

CP002000_5439: domain 1 of 1, from 197 to 264: score 73.4, E = 5.5e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR+LHDs++Q Ls+ l+l++ +r ++ ++ar++++e+
CP002000_5 197 ERARIARDLHDSLAQELSGSVLMLQATERNW--PDRTDAARARVREV 241

relarealaevRrllgdLRpaal<-*
+ +++ lae+Rr+++dL p+al
CP002000_5 242 VDRLQDELAETRRVIRDLAPSAL 264

CP002000_2739: domain 1 of 1, from 202 to 269: score 72.9, E = 7.8e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R+R+ARELHDs+g++L+ ++q+ +a+ l+ ++dp+++r+al +i
CP002000_2 202 QRNRLARELHDSIGHTLTTSTIQAAAAAELV--EADPAQVRRALGTI 246

relarealaevRrllgdLRpaal<-*
+e++r al+++ ++lg LR+
CP002000_2 247 EEASRSALEDLDHVLGLLREEPA 269

CP002000_6106: domain 1 of 1, from 176 to 243: score 72.0, E = 1.4e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+ +AR+LHD+v+++ sa+++ +++ ++++ ++ pe+a+eal+ i
CP002000_6 176 EREGLARDLHDTVAHHVSAMAIRAQAGLAMM--PSQPEAAAEALQLI 220

relarealaevRrllgdLRpaal<-*
++ a +al+e+R+++++LR ++
CP002000_6 221 EAEAARALDEMRAMVRVLRRDEP 243

CP002000_0042: domain 1 of 1, from 402 to 469: score 71.9, E = 1.5e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD++ +L a+ ++l+++++l+ d+dp++a++ ++e+
CP002000_0 402 ELRRIERDLHDGIQSRLVAMGMKLGAVEALV--DTDPAAAKRLAAEL 446

relarealaevRrllgdLRpaal<-*
r++++eal+e+R l+++++p++l
CP002000_0 447 RAASSEALTELRVLIRGIHPPVL 469

CP002000_6777: domain 2 of 2, from 578 to 645: score 71.4, E = 2.2e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R AR+LHD +g sLsai+l++el +r+l + d ++a+e+l+e+
CP002000_6 578 ERLRFARDLHDLLGMSLSAIALKSELTARVL--PLDRDRAAEELTEV 622

relarealaevRrllgdLRpaal<-*
+l r+al++vR +++++R+ l
CP002000_6 623 LGLTRQALSDVRSVASGYRELSL 645

CP002000_5338: domain 1 of 1, from 198 to 265: score 71.3, E = 2.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+A+E+HD+vgQ+L+++ + + +a +++ ++dpe+a e+l+ +
CP002000_5 198 ERYRLAQEIHDTVGQGLTSLLMLIRAADAAI--PADPERAHERLALA 242

relarealaevRrllgdLRpaal<-*
+++a e laevR+++++ pa+l
CP002000_5 243 QKTATENLAEVRAVISASGPAGL 265

CP002000_8326: domain 1 of 1, from 192 to 259: score 71.3, E = 2.3e-20
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ARE+HD+++Q++++i +++++ l d+dp++ar++++ +
CP002000_8 192 ERERLAREIHDTLAQGFTSIVTLAQAIESEL--DSDPAAARRHAELA 236

relarealaevRrllgdLRpaal<-*
++ar+ l+e+R+++ +L pa+l
CP002000_8 237 TRTARDNLTEARAMVAALAPADL 259

CP002000_3651: domain 1 of 1, from 179 to 249: score 69.1, E = 1e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ER+RIAR++HD++++sL a+++ql++a +ll ++ ++++ar +++
CP002000_3 179 ERTRIARDIHDVLAHSLGAVAVQLDAADALL--EAGTGtpRARHHVQ 223

eirelarealaevRrllgdLR.paal<-*
++r+l ++l+e+Rr++g+LR++a
CP002000_3 224 RARHLTVDGLTEARRAVGALRnDAPP 249

CP002000_6781: domain 1 of 1, from 185 to 252: score 68.1, E = 1.9e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R +R+LHD +g sLsai+l+ el+ rl+ + pe+a+++l+e+
CP002000_6 185 ERKRFSRDLHDLLGLSLSAITLKGELVDRLV--PGRPEQAKAELAEL 229

relarealaevRrllgdLRpaal<-*
++r+ala+vRr++ ++R+ l
CP002000_6 230 LVMSRRALADVRRIAAGYRELSL 252

CP002000_1248: domain 1 of 1, from 187 to 254: score 67.8, E = 2.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI R+LHD+ Q+L a+++ l++a+ + d dp+++re +de+
CP002000_1 187 ERRRIERDLHDGAQQRLVAVAMSLGRAKSKF--DQDPQAVRELIDEA 231

relarealaevRrllgdLRpaal<-*
+ a+ a +e+R+l++++ pa+l
CP002000_1 232 HSDAKLAVSELRDLARGIYPAVL 254

CP002000_2381: domain 1 of 1, from 171 to 240: score 66.8, E = 4.7e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe..eareald
ERaRIARELHD++++sL++++l l++ar +l +d +++ a ++++
CP002000_2 171 ERARIARELHDVLAHSLAGLALNLQGARLML--VRDGAspDAVAQIE 215

eirelarealaevRrllgdLRpaal<-*
++++la+e+lae+R ++ +LR++a
CP002000_2 216 RAQTLASEGLAEARKAVAALREDAV 240

CP002000_3977: domain 1 of 1, from 224 to 291: score 66.2, E = 7.2e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +L a+ + l++a r+l d++pe+ar +de+
CP002000_3 224 ELRRIERDLHDGAQTHLVAMGMTLDAAMRVL--DSHPEAARSLMDEA 268

relarealaevRrllgdLRpaal<-*
+ ++ +al+++R+l+++++p++l
CP002000_3 269 KNTSAKALQQLRDLVRGIQPPVL 291

CP002000_1375: domain 1 of 1, from 209 to 276: score 65.7, E = 1e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R+LHD+ +++a+ lql+ a +l+ d+dpe +r+ l +
CP002000_1 209 ELRRIERDLHDGTQARIAAVVLQLGIAGQLY--DRDPETVRDLLVKA 253

relarealaevRrllgdLRpaal<-*
+++a +alae+R +++ + p+ l
CP002000_1 254 QDTATDALAELRTVVRSIYPPLL 276

CP002000_0962: domain 1 of 1, from 171 to 238: score 65.5, E = 1.2e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +IARELHDs+ +++s+ik+q+e+a +l+ k e + +al +i
CP002000_0 171 ERLHIARELHDSLTHQISVIKVQAEVAVHLA--GKRGEDVPDALLAI 215

relarealaevRrllgdLRpaal<-*
r+++rea +e+R++l +LR+++
CP002000_0 216 RDAGREAARELRATLEALRDDDK 238

CP002000_9133: domain 1 of 1, from 385 to 453: score 65.0, E = 1.7e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER +ARELHD v+++ ++i +q+++ar ++ +k+p+ a +a+ +i
CP002000_9 385 ERMALARELHDIVAHHVTGIVVQAQAARLMA--EKNPQIAVDAMGRI 429

relarealaevRrllgdLR.paal<-*
+ ++ eala +Rrl++ +R++a
CP002000_9 430 ENAGVEALAAMRRLVRSMRgDAPA 453

CP002000_6410: domain 1 of 1, from 203 to 266: score 63.8, E = 3.8e-18
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERa IARE+HD v+++Ls+++ +++a++++ ++d+++a+++ +
CP002000_6 203 ERAIIAREMHDIVAHNLSVMIALADGAAYAA--RTDAGAAETTSLHV 247

relarealaevRrllgdLR<-*
+++r+al+e+ rllg+LR
CP002000_6 248 SATGRQALDEMHRLLGVLR 266

CP002000_2900: domain 1 of 2, from 195 to 261: score 62.0, E = 1.3e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER R+ARELHD v++++s+i + +++a+r++ +++ + + +++e+
CP002000_2 195 ERLRLARELHDLVAHQISGIVVRVQAAHRVA--ERAGGDTA-TFAEL 238

relarealaevRrllgdLRpaal<-*
++++ +al+ +Rrl+g+LR++++
CP002000_2 239 ETAGATALSAMRRLVGALRTGDE 261

CP002000_7124: domain 1 of 1, from 176 to 244: score 61.6, E = 1.7e-17
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER RIAR+LHD++g+ ++++++l++a+ +l ++ +++ar+ l+++
CP002000_7 176 ERVRIARDLHDVLGHEVALVSMHLGAAEVHL--PEGAQAARADLAAA 220

relarealaevRrllgdLR.paal<-*
r+ ++ l+e+ ++l +LR +++
CP002000_7 221 RAGVQAVLRETQQVLAALRvSGDD 244

CP002000_0465: domain 2 of 2, from 220 to 287: score 58.5, E = 1.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E +RI R LHD+ +L a+++ l++a+r+l ++dp++a+e ld++
CP002000_0 220 ELRRIERSLHDGTQNRLVAVNVLLGAAKRAL--TRDPAAAEEILDRA 264

relarealaevRrllgdLRpaal<-*
+++a++alae+R +++ + p++l
CP002000_0 265 QDAAEQALAELRGVVRSILPPVL 287

CP002000_1523: domain 1 of 1, from 321 to 389: score 57.1, E = 3.4e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+ R+LHD+ Q+L ++ l l +a r+ ++ p+e+r+ l+ +
CP002000_1 321 ERRRLERDLHDGAQQRLVSVVLLLRMAGRRSG-AELPPEIRALLTGA 366

relarealaevRrllgdLRpaal<-*
+ +++a++e+R+l++++Rpa+l
CP002000_1 367 VDELQTAITELRELARGIRPAIL 389

CP002000_6257: domain 1 of 1, from 193 to 258: score 56.9, E = 3.9e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A E+HD+v ++Ls++ l+++++ +++ +ar+a++ i
CP002000_6 193 ERRRLAGEMHDVVTHRLSLMVLHAGALGVTS--ADP--AARTAAEDI 235

relarealaevRrllgdLRpaal<-*
r+ + al+e+R+l+g+LR +a+
CP002000_6 236 RREGALALDELRDLVGVLRNGAE 258

CP002000_4323: domain 1 of 1, from 294 to 360: score 56.5, E = 5.2e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a l+le++ rl+ +++ ++++++
CP002000_4 294 DRDRIARDLHDLVIQRLFATGLGLEGVSRLI--ADA--GVAARVAGF 336

relarealaevRrllgdLR.paal<-*
++ ++ +++e+R+ + L+ pa+
CP002000_4 337 AQDLDGTIREIRNSIFSLQaPAQA 360

CP002000_0164: domain 1 of 1, from 109 to 178: score 55.3, E = 1.2e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARELHD++ Q+L ++ +ql+++rr ++ ++ +++ ++l +
CP002000_0 109 ERERIARELHDVIVQRLYGAGMQLDRVRRNMR-KRFAQADGARLSDA 154

relarealaevRrllgdLR.paal<-*
+ ++++++e+R ++++LR+p
CP002000_0 155 IDQLDQTIEEIRGTVRALRsPEPR 178

CP002000_6100: domain 1 of 1, from 175 to 244: score 53.2, E = 5.1e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealde
ER +ARELHD v+++ s+i + +++ar++++ +k++e+ ++ +e
CP002000_6 175 ERLQLARELHDLVSHHVSGIVVRVQAARAITE-AKPDEdNHAAVYRE 220

irelarealaevRrllgdLRpaal<-*
i+e+++ ala +Rrl+g LR+++
CP002000_6 221 IEEAGSAALAAARRLVGMLRDTEG 244

CP002000_5405: domain 1 of 1, from 389 to 454: score 50.6, E = 2.8e-14
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l ++ +r++ +++ e++++l
CP002000_5 389 DRDRIARDLHDHVIQRLFAVGLSMQSTQRRT--KSP--ELQKRLGDS 431

relarealaevRrllgdLRpaal<-*
e +e +e+R ++ dL+ +a
CP002000_5 432 IEQMHEIVQEIRTAIFDLHGGAA 454

CP002000_5099: domain 2 of 2, from 272 to 336: score 48.4, E = 1.3e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA + HD+ Qs+ a+ + l+l++ + pe+ + a+ +
CP002000_5 272 ERRRIAWDVHDESIQSMVAVGMRLQLLA-----SRLPEPHASAVGSL 313

relarealaevRrllgdLRpaal<-*
e + a+a +R l+++LRp++l
CP002000_5 314 DESVTAAIARLRGLVSRLRPPEL 336

CP002000_1265: domain 1 of 1, from 182 to 248: score 47.6, E = 2.2e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIA ++HDs+g+ Ls+i++ + +++ ++ ++ r+a++++
CP002000_1 182 ERARIASDMHDSLGHELSLIAVRAAALE-VA--GGLGDAQRDAAAQL 225

relarealaevRrllgdLRpaal<-*
r+ a +a + +R+++g+LR++a
CP002000_1 226 RTSAATATERLREIIGVLREDAA 248

CP002000_3117: domain 1 of 1, from 153 to 221: score 47.4, E = 2.5e-13
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RI RELHD ++s ++ lel + d+dp++ar+++ ++
CP002000_3 153 ERRRIGRELHDRAAHSVGVALQDLELYDVYA--DTDPPRARARIGTA 197

relarealaevRrllgdLR.paal<-*
r+++real+ +R l+++LR+ a++
CP002000_3 198 RTALREALESIRGLARELReSAVE 221

CP002000_2065: domain 1 of 1, from 247 to 313: score 47.4, E = 2.5e-13
*->aRIARELHDsvgQsLsaiklqlelarrlldsdkdpe.earealdeir
+RI R+LHD+ +L a++++l+la+ l +++ +++ e +++++
CP002000_2 247 RRIERDLHDGAQAQLVALAMKLGLAKDEL--ADAGLpQVNELVTAAH 291

elarealaevRrllgdLRpaal<-*
+ a++al+e+R+l+++++paal
CP002000_2 292 ANAKQALTELRDLARGIHPAAL 313

CP002000_5501: domain 1 of 1, from 339 to 405: score 43.7, E = 3.1e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R RIAR+LHD v Q+L+a+ l++e+ rr ++d +++ +l +
CP002000_5 339 DRDRIARDLHDHVIQRLFAVGLGIEGTRR----RSDSPAVTSRLIQH 381

relarealaevRrllgdLR.paal<-*
+ +++ ++e+R ++ +L+ ++
CP002000_5 382 IDQLQDVIEEIRSAIFALHaQPGA 405

CP002000_1452: domain 2 of 2, from 176 to 244: score 42.7, E = 6e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+R+A +LHDsvg L+ai ++ ++ + ++dp e+r++l+ +
CP002000_1 176 ERRRMAADLHDSVGALLFAIGSGMADLAEST--QADP-ELRARLEGL 219

relarealaevRrllgdLR..paal<-*
r+ a +a + +R+ l++LR++paal
CP002000_1 220 RRQAVDATTALRESLRTLRssPAAL 244

CP002000_6777: domain 1 of 2, from 204 to 271: score 41.9, E = 1e-11
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
R AR+L D +g sLsai+l+ el++rl+ +k e+a+++l+ i
CP002000_6 204 QRLAFARDLNDLLGLSLSAIALKGELVHRLM--RKSVEQAKAELADI 248

relarealaevRrllgdLRpaal<-*
++a+++l++vR++ +++R+ l
CP002000_6 249 TATAQRTLSDVRAVSHGYRELSL 271

CP002000_4765: domain 1 of 1, from 26 to 86: score 41.6, E = 1.3e-11
*->ELHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelarea
+LHD++g +L+a+ l+l +ar l+ +d ++ + l+++++ + a
CP002000_4 26 DLHDGLGPTLTAAVLGLRAARDLI--GRDRAATEHLLARLEDELYGA 70

laevRrllgdLRpaal<-*
++++Rr++ d Rp+al
CP002000_4 71 ITDLRRIVADARPPAL 86

CP002000_5896: domain 1 of 1, from 141 to 199: score 35.4, E = 8.8e-10
*->LHDsvgQsLsaiklqlelarrlldsdkdpeearealdeirelareal
LHD+++Q+ +++ +q+e++r++ + ++ re+ld++ +++r al
CP002000_5 141 LHDTLAQTTAVMLVQAETLRAVG---DLTDADRERLDTLLAAGRGAL 184

aevRrllgdLRpaal<-*
+ vRr+l dLR++a+
CP002000_5 185 TLVRRTLDDLRDDAE 199


Histogram of all scores:
score obs exp (one = represents 25 sequences)
----- --- ---
-14 3 0|=
-13 54 1|*==
-12 128 103|====*=
-11 255 845|=========== *
-10 840 1962|================================== *
-9 1451 2228|==========================================================*
-8 1358 1717|======================================================= *
-7 1380 1079|===========================================*============
-6 1157 611|========================*======================
-5 1029 327|=============*============================
-4 527 171|======*===============
-3 380 88|===*============
-2 240 44|=*========
-1 146 22|*=====
0 86 11|*===
1 53 5|*==
2 37 2|*=
3 18 1|*
4 15 0|=
5 12 0|=
6 0 0|
7 5 0|=
> 8 54 -|===


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 7545.6689
P(chi-square) = 0

Total sequences searched: 9228

Whole sequence top hits:
tophits_s report:
Total hits: 48
Satisfying E cutoff: 48
Total memory: 22K

Domain top hits:
tophits_s report:
Total hits: 49
Satisfying E cutoff: 49
Total memory: 38K


Acknowledgements:

This research is funded by:

Developed by: