Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Caulobacter segnis ATCC 21756  

Data for CP002008  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_2.hmm [HisKA_2]
Sequence database: CP002008.Gprot.fsa
per-sequence score cutoff: >= 32.2 [TC1]
per-domain score cutoff: >= 32.2 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_2
Accession: PF07568.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002008_3912 CDS_4427580-4425886 123.9 4.7e-35 1
CP002008_3757 CDS_4251849-4252949 123.8 5.1e-35 1
CP002008_0526 CDS_585213-584128 77.0 1e-21 1
CP002008_0711 CDS_771563-770469 69.6 1.3e-19 1
CP002008_0732 CDS_801974-802960 54.1 3.3e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002008_3912 1/1 368 454 .. 1 94 [] 123.9 4.7e-35
CP002008_3757 1/1 177 265 .. 1 94 [] 123.8 5.1e-35
CP002008_0526 1/1 171 256 .. 1 94 [] 77.0 1e-21
CP002008_0711 1/1 161 244 .. 1 94 [] 69.6 1.3e-19
CP002008_0732 1/1 137 217 .. 1 94 [] 54.1 3.3e-15

Alignments of top-scoring domains:
CP002008_3912: domain 1 of 1, from 368 to 454: score 123.9, E = 4.7e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EIHHRVKNNLQ+I+SLL++Q r d+++ ++a++++++R+ +
CP002008_3 368 EIHHRVKNNLQIITSLLNMQQRALADPAA-----KAAMNDTRQRITA 409

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
A+i++ LY++ dl++vd++++le+Lt++L+ ++ s+ ++ + +
CP002008_3 410 LAQIYRALYQGPDLKRVDLRPFLEELTAQLLANDMGTSGLVQTE--V 454

CP002008_3757: domain 1 of 1, from 177 to 265: score 123.8, E = 5.1e-35
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQ+ISSLL LQ+r++ d++ ++ L+ +RV +
CP002008_3 177 EVDHRVKNNLQLISSLLLLQTRRVPDPDL-----KASLKGMLGRVNA 218

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A++H++L +sed+++ d+s++++ ++++L+ s++++++ i+L+l+
CP002008_3 219 IATVHRRLFQSEDVERFDVSAFIRDMVADLMGSAARDDIEIQLDLER 265

CP002008_0526: domain 1 of 1, from 171 to 256: score 77.0, E = 1e-21
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E+ HRVKNNLQv+ +LL + ar+ d+++ ++a++E + RV +
CP002008_0 171 EVYHRVKNNLQVVDGLLFMRARQLGDPAA-----KAAMEEIRKRVFA 212

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
l+H +L s+dl+t d++++l++L+++L+ + +++sL lD+
CP002008_0 213 LGLVHHQLMGSKDLKTFDVGAFLKELIAHLRA---DAPENVSLALDV 256

CP002008_0711: domain 1 of 1, from 161 to 244: score 69.6, E = 1.3e-19
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
EI HRV N+LQ+I++ L+ ar +++ee+ +e Lr+++ RV+S
CP002008_0 161 EIRHRVANSLQIIAAVLMQNARAAQSEEA-----REKLRDAHARVMS 202

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A ++++L + ++ v++++Yl+kL++ + s+ + +++ l
CP002008_0 203 IADLQQQLAEA-TTGVVELRAYLTKLCATIAASMIPDPSRLA----L 244

CP002008_0732: domain 1 of 1, from 137 to 217: score 54.1, E = 3.3e-15
*->EIHHRVKNNLQvISSLLrLQarkfkdeevikdEVleaLrEsqnRVlS
E HHRV NNLQv +LLrLQ + ++d ++ + + + R+
CP002008_0 137 ELHHRVSNNLQVAGALLRLQGQGVSDVDA-----RQVIDQAGARIEV 178

mAliHEeLYksedldtvdfseYlekLtenLfqsygvgsdgisLklDl<-*
+A+i++eL+ + + v f+ + e L+++ ++g + l
CP002008_0 179 IAQIQRELHNAVG-EPVPFRVFAEALLASAAAAAGARVA-------L 217


Histogram of all scores:
score obs exp (one = represents 21 sequences)
----- --- ---
-15 14 0|=
-14 36 0|==
-13 64 25|=*==
-12 253 271|============*
-11 1183 756|===================================*=====================
-10 969 979|==============================================*
-9 622 827|============================== *
-8 463 555|======================= *
-7 219 329|=========== *
-6 173 183|========*
-5 50 98|=== *
-4 31 52|==*
-3 27 27|=*
-2 7 14|*
-1 7 7|*
0 1 3|*
1 2 2|*
2 0 1|*
3 1 0|=
4 0 0|
> 5 17 -|=


% Statistical details of theoretical EVD fit:
mu = -9.5227
lambda = 0.6548
chi-sq statistic = 437.8566
P(chi-square) = 0

Total sequences searched: 4139

Whole sequence top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 5
Satisfying E cutoff: 5
Total memory: 22K


Acknowledgements:

This research is funded by:

Developed by: