Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
132 projects found  

1 accessions found for Caulobacter segnis ATCC 21756  

Data for CP002008  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP002008.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002008_0764 CDS_843854-842373 155.5 8.3e-53 1
CP002008_0146 CDS_173885-172452 153.2 5.3e-52 1
CP002008_3432 CDS_3869701-3868358 146.3 1.1e-49 1
CP002008_3362 CDS_3791863-3789758 141.5 5e-48 1
CP002008_0850 CDS_949728-947464 140.6 1e-47 1
CP002008_0171 CDS_203303-202146 136.9 1.9e-46 1
CP002008_1103 CDS_1222637-1221621 133.6 2.4e-45 1
CP002008_2223 CDS_2512487-2514076 133.0 3.9e-45 1
CP002008_3926 CDS_4435003-4436841 127.5 3e-43 1
CP002008_3400 CDS_3835269-3836864 124.8 2.4e-42 1
CP002008_0910 CDS_1009908-1008238 117.2 9.4e-40 1
CP002008_3947 CDS_4460531-4457997 101.5 2.1e-34 1
CP002008_1172 CDS_1293120-1294133 98.8 1.8e-33 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002008_0764 1/1 298 379 .. 1 85 [] 155.5 8.3e-53
CP002008_0146 1/1 293 372 .. 1 85 [] 153.2 5.3e-52
CP002008_3432 1/1 262 345 .. 1 85 [] 146.3 1.1e-49
CP002008_3362 1/1 507 586 .. 1 85 [] 141.5 5e-48
CP002008_0850 1/1 568 648 .. 1 85 [] 140.6 1e-47
CP002008_0171 1/1 190 272 .. 1 85 [] 136.9 1.9e-46
CP002008_1103 1/1 143 224 .. 1 85 [] 133.6 2.4e-45
CP002008_2223 1/1 348 424 .. 1 85 [] 133.0 3.9e-45
CP002008_3926 1/1 282 361 .. 1 85 [] 127.5 3e-43
CP002008_3400 1/1 345 422 .. 1 82 [. 124.8 2.4e-42
CP002008_0910 1/1 368 444 .. 1 85 [] 117.2 9.4e-40
CP002008_3947 1/1 527 609 .. 1 85 [] 101.5 2.1e-34
CP002008_1172 1/1 154 233 .. 1 85 [] 98.8 1.8e-33

Alignments of top-scoring domains:
CP002008_0764: domain 1 of 1, from 298 to 379: score 155.5, E = 8.3e-53
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a QTlRn++++ + e+F++RL Lsr+Hd+
CP002008_0 298 ELNHRVKNTLATVQSMASQTLRNEPDPMVAFEKFEARLLGLSRVHDI 344

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W gA+Lre++e++L+P+ +e++ R+ ++GP+
CP002008_0 345 --LTRESWHGAELREVAERALQPF-DEAGARVSIEGPP 379

CP002008_0146: domain 1 of 1, from 293 to 372: score 153.2, E = 5.3e-52
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ+ia+QTlR+a+++ f+eaF+ RL ALs++H+
CP002008_0 293 ELNHRVKNTLATVQAIAQQTLRGAEDPSVFAEAFESRLLALSQTHNA 339

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+s+WagA Lr++l +eL+P+g +eR+ l+G+d
CP002008_0 340 --LTDSHWAGAGLRQILDQELGPHG---GERVALEGED 372

CP002008_3432: domain 1 of 1, from 262 to 345: score 146.3, E = 1.1e-49
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL+ +QSiarQTlR+ + + ++++F+ RL+A+s+aH++
CP002008_3 262 ELNHRVKNTLSSIQSIARQTLRSDDVAPRARDQFIERLMAMSAAHNV 308

VpLtrseWagAdLreLleaeLaPygge.daeRitlsGPd<-*
Lt ++W+gA + ++l+++L+P+++++d++Ri + GP+
CP002008_3 309 --LTSESWSGAVIDDILREALRPFADDqDPDRISIKGPS 345

CP002008_3362: domain 1 of 1, from 507 to 586: score 141.5, E = 5e-48
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQS+a+QTlR++++l+ ++eaF+ RL+ALs++H+L
CP002008_3 507 ELNHRVKNTLATVQSLAAQTLRSSDDLATAREAFDRRLMALSATHNL 553

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+s+W +A+L++L++++ +P+ a+R+ +GP+
CP002008_3 554 --LTQSSWTSAELGDLVRQAAEPFV---ADRFIAEGPS 586

CP002008_0850: domain 1 of 1, from 568 to 648: score 140.6, E = 1e-47
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E+nHRVKN+LA++Q+ia+Q++ a sl++++eaF++RL+AL++aHdL
CP002008_0 568 EMNHRVKNSLATIQAIAAQSFTDAHSLPQAKEAFADRLVALAEAHDL 614

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdL++++e+ a +gg a+R++lsGP+
CP002008_0 615 --LTRENWEGADLHKVAERLAALHGG--ADRFELSGPA 648

CP002008_0171: domain 1 of 1, from 190 to 272: score 136.9, E = 1.9e-46
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HRVKNtLA+VQSi rQTlR ++s+++f+e F+ R+ ALs+aH L
CP002008_0 190 ELDHRVKNTLAIVQSISRQTLRASPSPEAFAEVFENRILALSQAHEL 236

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr+ W+ A L+e+le +LaP+ + a+R+ + GP+
CP002008_0 237 --LTRRAWGRAQLHEILEKALAPFSVDLADRFDIIGPA 272

CP002008_1103: domain 1 of 1, from 143 to 224: score 133.6, E = 2.4e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA++QSi Q+lRna+ + ++a++gRL+A +++H++
CP002008_1 143 ELNHRVKNTLATIQSITKQSLRNAGVDGAVRDALEGRLMAIAATHNV 189

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt+ +W+ A+Lr+++ + Py+++ + ++t++GPd
CP002008_1 190 --LTDQNWSAASLRQIVDGSVTPYRSN-PAQLTVTGPD 224

CP002008_2223: domain 1 of 1, from 348 to 424: score 133.0, E = 3.9e-45
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtL vVQS+ar++lR + +++F +R++AL++aHdL
CP002008_2 348 ELNHRVKNTLVVVQSLARHSLR--DGGLLGLRQFNDRIHALASAHDL 392

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Ltr++W+gAdL+e+l+++L+Py a ++tl+GP+
CP002008_2 393 --LTRRSWEGADLGEILAETLQPY----ASQVTLEGPP 424

CP002008_3926: domain 1 of 1, from 282 to 361: score 127.5, E = 3e-43
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL+HR+KN+LAvVQS+a+Q++R +asld f+ +F++RL ++s+aHdL
CP002008_3 282 ELDHRIKNLLAVVQSVAAQSARKSASLDVFLKTFAARLKSMSSAHDL 328

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L+ ++W+gA+L+ +++aeL+ + +++ +++GP+
CP002008_3 329 --LSAARWRGATLARIAAAELGGLA---PTQTRWDGPE 361

CP002008_3400: domain 1 of 1, from 345 to 422: score 124.8, E = 2.4e-42
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKN+LA+VQSia+QTlR+ as++ f+eaF++RL ALs +HdL
CP002008_3 345 ELNHRVKNSLATVQSIAAQTLRSIASPEFFREAFEARLIALSHTHDL 391

VpLtrseWagAdLreLleaeLaPyggedaeRitls<-*
Ltr++W+gA+Lre+ eL++ +g ++R+t++
CP002008_3 392 --LTRESWEGASLREVFDGELRAMAG--EDRVTFD 422

CP002008_0910: domain 1 of 1, from 368 to 444: score 117.2, E = 9.4e-40
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRVKNtLA+VQ++arQT + + + v+ F+ RL ALs+aHdL
CP002008_0 368 ELNHRVKNTLATVQALARQT--FLKTEGAPVDVFTERLIALSGAHDL 412

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
Lt + W+ Ad+ +L++ +L+++ ++R++ +GP+
CP002008_0 413 --LTKTGWREADMDQLVQKALGAH----SGRVRREGPT 444

CP002008_3947: domain 1 of 1, from 527 to 609: score 101.5, E = 2.1e-34
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
ELnHRV+N+L ++ +++ Q++ + ++++f+e + gR qAL+raHd+
CP002008_3 527 ELNHRVRNILGLIRGLISQSRAGVSTVEQFAEVVGGRVQALARAHDQ 573

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
+tr++W+++ L++L++ae ++y ++ a+R++l G +
CP002008_3 574 --ITRHQWGPGALSDLITAEAEAYLSDKADRVRLKGAP 609

CP002008_1172: domain 1 of 1, from 154 to 233: score 98.8, E = 1.8e-33
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
E HR KNtLA+VQ+ia+QTlR ++ + v+aF++RL+AL++aHd+
CP002008_1 154 ETTHRLKNTLALVQAIAQQTLRDVPDRER-VQAFDDRLHALASAHDV 199

VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L ++eW gAdL L+e +L+ + + R++++GP+
CP002008_1 200 --LLQHEWNGADLQGLVETALGRLVD--RARFHVEGPQ 233


Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-16 1 0|=
-15 0 0|
-14 11 0|=
-13 39 0|===
-12 271 0|====================
-11 382 33|==*=========================
-10 547 428|==============================*=========
-9 730 1059|===================================================== *
-8 812 1099|==========================================================*
-7 506 738|===================================== *
-6 335 403|======================== *
-5 204 199|==============*
-4 117 94|======*==
-3 82 43|===*==
-2 34 20|=*=
-1 24 9|*=
0 16 4|*=
1 5 1|*
2 3 0|=
3 0 0|
4 1 0|=
> 5 19 -|==


% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 3950.6348
P(chi-square) = 0

Total sequences searched: 4139

Whole sequence top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 21K

Domain top hits:
tophits_s report:
Total hits: 13
Satisfying E cutoff: 13
Total memory: 26K


Acknowledgements:

This research is funded by:

Developed by: