Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
106 projects found  

1 accessions found for   

Data for CP002010  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002010.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002010_0802 CDS_1013533-1012193 71.2 5.2e-21 1
CP002010_0769 CDS_977296-974903 67.3 7.4e-20 3
CP002010_1070 CDS_1307453-1306164 51.8 2.8e-15 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002010_0802 1/1 211 280 .. 1 70 [] 71.2 5.2e-21
CP002010_1070 1/1 210 277 .. 1 70 [] 51.8 2.8e-15
CP002010_0769 1/3 244 302 .. 1 61 [. 51.5 3.4e-15

Alignments of top-scoring domains:
CP002010_0802: domain 1 of 1, from 211 to 280: score 71.2, E = 5.2e-21
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIARE+HD vg+ L+ +++q+++ r++++ ++++ a++ ++++
CP002010_0 211 ERTRIAREIHDNVGHLLTRAIMQAQAGRTVAE-ATNDTVAAQGFATL 256

relarealaevRrllgdLR.paal<-*
+++++a++ vRr ++dL +++++
CP002010_0 257 GATLDDAMTMVRRSVHDLEdDGTD 280

CP002010_1070: domain 1 of 1, from 210 to 277: score 51.8, E = 2.8e-15
*->ERaR..IARELHDsvgQsLsaiklqlelarrlldsdkdpeeareald
ER+R + A ELHDsvg++L+ai+ +e+++ l+ e+++ a++
CP002010_1 210 ERRRadVAAELHDSVGHNLTAIIALTEGLEGLT-----QEPVEGAIK 251

eirelarealaevRrllgdLR.paal<-*
i lar++l ++R++++ L +p +l
CP002010_1 252 SINNLARQSLGDTREAVRKLSsPVTL 277

CP002010_0769: domain 1 of 3, from 244 to 302: score 51.5, E = 3.4e-15
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ERaRIAR++HD+v+++Ls i++q+++ r++ + d + a+ ++ +i
CP002010_0 244 ERARIARDMHDVVAHTLSTIIVQSDGGRYAG--AHDLAIAKHTMGTI 288

relarealaevRrl<-*
r+ a++a+ ++ rl
CP002010_0 289 RHEAERAQHDMQRL 302


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-14 5 0|=
-13 36 0|======
-12 55 21|==*=====
-11 104 179|=============== *
-10 264 416|====================================== *
-9 381 473|======================================================= *
-8 274 364|======================================== *
-7 254 229|================================*====
-6 195 129|==================*=========
-5 196 69|=========*==================
-4 59 36|=====*===
-3 45 18|==*====
-2 40 9|=*====
-1 22 4|*===
0 9 2|*=
1 5 1|*
2 6 0|=
3 2 0|=
4 0 0|
5 2 0|=
6 0 0|
7 0 0|
> 8 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 591.7958
P(chi-square) = 0

Total sequences searched: 1959

Whole sequence top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 3
Satisfying E cutoff: 3
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: