Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia sp. CCGE1002  

Data for CP002013  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002013.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002013_1899 CDS_2189785-2191422 54.3 7.7e-16 1
CP002013_0089 CDS_107476-106589 35.0 3.7e-10 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002013_1899 1/1 322 389 .. 1 70 [] 54.3 7.7e-16
CP002013_0089 1/1 53 116 .. 1 58 [. 35.0 3.7e-10

Alignments of top-scoring domains:
CP002013_1899: domain 1 of 1, from 322 to 389: score 54.3, E = 7.7e-16
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
E + +ARELHD++g L+a ++ + +arr l ++ + +++ l+++
CP002013_1 322 EKTQLARELHDELGAILTACRMDVAWARRKL--KDSEPDIADKLQRA 366

relarealaevRrllgdLRpaal<-*
+ +++++a Rr++ d+Rp++l
CP002013_1 367 LANLDQGIALKRRIIEDMRPTVL 389

CP002013_0089: domain 1 of 1, from 53 to 116: score 35.0, E = 3.7e-10
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe........e
R++ ARELHD+vg L+a + l ++++ l ++d++++
CP002013_0 53 VRRHVARELHDGVGAELTATRFALAGIETWL--PTDAPpqcaaalaV 97

arealdeirelarealaev<-*
a + ld++++++rea+a++
CP002013_0 98 ANRSLDAVHAASREAIAQL 116


Histogram of all scores:
score obs exp (one = represents 10 sequences)
----- --- ---
-14 6 0|=
-13 35 0|====
-12 79 34|===*====
-11 127 285|============= *
-10 408 662|========================================= *
-9 551 752|======================================================== *
-8 465 579|=============================================== *
-7 406 364|====================================*====
-6 333 206|====================*=============
-5 302 110|==========*====================
-4 153 57|=====*==========
-3 95 29|==*=======
-2 54 15|=*====
-1 38 7|*===
0 20 3|*=
1 18 1|*=
2 8 1|*
3 7 0|=
4 4 0|=
5 2 0|=
> 6 5 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 1250.0398
P(chi-square) = 0

Total sequences searched: 3116

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: