Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia sp. CCGE1002  

Data for CP002014  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002014.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002014_1199 CDS_1369100-1370515 64.6 5.3e-19 1
CP002014_0004 CDS_3734-4732 42.8 1.4e-12 1

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002014_1199 1/1 253 323 .. 1 70 [] 64.6 5.3e-19
CP002014_0004 1/1 119 186 .. 1 70 [] 42.8 1.4e-12

Alignments of top-scoring domains:
CP002014_1199: domain 1 of 1, from 253 to 323: score 64.6, E = 5.3e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpe...eareal
ERaR++RELHD+++Q++ ++kl le a+++l ++ +++ ++a++al
CP002014_1 253 ERARLSRELHDGISQMMVSVKLLLESALARL--ERGDArvpAAEAAL 297

deirelarealaevRrllgdLRpaal<-*
+ + + ++l+evRr+ ++LRp+ l
CP002014_1 298 STGLTRLGDTLREVRRISHALRPSML 323

CP002014_0004: domain 1 of 1, from 119 to 186: score 42.8, E = 1.4e-12
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+++ARELHD++gQ L a++l + ++r l + +e+ + + +
CP002014_0 119 ERRHMARELHDELGQYLNAMSLDAVRIRDLS--GEREPEIHRIALGL 163

relarealaevRrllgdLRpaal<-*
+ a + ++e+ ++++LRp +l
CP002014_0 164 IQSATHVYREIGGMIRRLRPIGL 186


Histogram of all scores:
score obs exp (one = represents 7 sequences)
----- --- ---
-17 1 0|=
-16 0 0|
-15 0 0|
-14 2 0|=
-13 29 0|=====
-12 57 25|===*=====
-11 101 206|=============== *
-10 244 480|=================================== *
-9 387 545|======================================================== *
-8 377 420|====================================================== *
-7 322 264|=====================================*========
-6 245 149|=====================*=============
-5 217 80|===========*===================
-4 113 41|=====*===========
-3 63 21|==*======
-2 45 11|=*=====
-1 20 5|*==
0 13 2|*=
1 7 1|*
2 3 0|=
3 3 0|=
4 1 0|=
5 4 0|=
6 1 0|=
7 0 0|
> 8 3 -|=


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 910.5374
P(chi-square) = 0

Total sequences searched: 2258

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: