Acidobacteria Actinobacteria Alphaproteobacteria
Aquificae Bacteroidetes/Chlorobi Betaproteobacteria
Chlamydiae/Verrucomicrobia Chloroflexi Cyanobacteria
Deinococcus-Thermus Deltaproteobacteria Epsilonproteobacteria
Firmicutes Fusobacteria Gammaproteobacteria
Other Bacteria Planctomycetes Spirochaetes
Thermotogae
Classification of phyla is from NCBI page
Search:
76 projects found  

4 accessions found for Burkholderia sp. CCGE1002  

Data for CP002016  

Available Atlases
Other Plots
hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HisKA_3.hmm [HisKA_3]
Sequence database: CP002016.Gprot.fsa
per-sequence score cutoff: >= 30.1 [TC1]
per-domain score cutoff: >= 30.1 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query HMM: HisKA_3
Accession: PF07730.2
Description: Histidine kinase
[HMM has been calibrated; E-values are empirical estimates]

Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002016_0140 CDS_173893-175518 77.8 1.2e-23 1
CP002016_0197 CDS_255869-261295 63.3 2.3e-19 2

Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002016_0140 1/1 340 406 .. 1 70 [] 77.8 1.2e-23
CP002016_0197 2/2 1613 1680 .. 1 70 [] 62.7 3.4e-19

Alignments of top-scoring domains:
CP002016_0140: domain 1 of 1, from 340 to 406: score 77.8, E = 1.2e-23
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER+RIA E+HD++gQ L+a+k+ ++l+++++ dp ea + +d +
CP002016_0 340 ERRRIAMEIHDELGQLLTALKMDVSLLKMRI--VHDP-EASKKADDM 383

relarealaevRrllgdLRpaal<-*
r+l++ +++ vR+++++LRpaal
CP002016_0 384 RQLVEGTISMVRNVASHLRPAAL 406

CP002016_0197: domain 2 of 2, from 1613 to 1680: score 62.7, E = 3.4e-19
*->ERaRIARELHDsvgQsLsaiklqlelarrlldsdkdpeearealdei
ER++IARE+HD++gQ+L+a++l ++ +r++l +d + + e+++++
CP002016_0 1613 ERKHIAREMHDELGQHLTALRLRASILRMRL--GADHPDLVEHAQAL 1657

relarealaevRrllgdLRpaal<-*
l++ +++ vR ++ LRpaal
CP002016_0 1658 VSLVDVTMQVVRGVIASLRPAAL 1680


Histogram of all scores:
score obs exp (one = represents 2 sequences)
----- --- ---
-14 1 0|=
-13 9 0|=====
-12 14 4|=*=====
-11 31 37|================ *
-10 40 86|==================== *
-9 83 98|========================================== *
-8 63 75|================================ *
-7 49 47|=======================*=
-6 44 26|============*=========
-5 28 14|======*=======
-4 10 7|===*=
-3 9 3|=*===
-2 7 1|*===
-1 8 1|*===
0 3 0|==
1 1 0|=
2 2 0|=
3 0 0|
4 1 0|=
5 0 0|
> 6 3 -|==


% Statistical details of theoretical EVD fit:
mu = -8.7900
lambda = 0.6787
chi-sq statistic = 54.8447
P(chi-square) = 1.6e-09

Total sequences searched: 406

Whole sequence top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 20K

Domain top hits:
tophits_s report:
Total hits: 2
Satisfying E cutoff: 2
Total memory: 21K


Acknowledgements:

This research is funded by:

Developed by: