hmmsearch - search a sequence database with a profile HMM
HMMER 2.3.2 (Oct 2003)
Copyright (C) 1992-2003 HHMI/Washington University School of Medicine
Freely distributed under the GNU General Public License (GPL)
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
HMM file: /home/projects/MicrobialGenomicsGroup/Packages/hmmdata-1.0.0.package/Resources/noarch/TCS/HWE_HK.hmm [HWE_HK]
Sequence database: CP002026.Gprot.fsa
per-sequence score cutoff: >= 60.0 [TC1]
per-domain score cutoff: >= 60.0 [TC2]
per-sequence Eval cutoff: [none]
per-domain Eval cutoff: [none]
- - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
Query HMM: HWE_HK
Accession: PF07536.4
Description: HWE histidine kinase
[HMM has been calibrated; E-values are empirical estimates]
Scores for complete sequences (score includes all domains):
Sequence Description Score E-value N
-------- ----------- ----- ------- ---
CP002026_0050 CDS_41405-40077 131.7 1.1e-44 1
Parsed for domains:
Sequence Domain seq-f seq-t hmm-f hmm-t score E-value
-------- ------- ----- ----- ----- ----- ----- -------
CP002026_0050 1/1 249 331 .. 1 85 [] 131.7 1.1e-44
Alignments of top-scoring domains:
CP002026_0050: domain 1 of 1, from 249 to 331: score 131.7, E = 1.1e-44
*->ELnHRVKNtLAvVQSiarQTlRnaasldefveaFsgRLqALsraHdL
EL HR+KN+LAv+Q++arQT+R+a+s+defve Fs+RLqALsr+HdL
CP002026_0 249 ELTHRSKNLLAVIQAMARQTARHAGSIDEFVEIFSARLQALSRSHDL 295
VpLtrseWagAdLreLleaeLaPyggedaeRitlsGPd<-*
L++++W gA L + ++++L+++ + ++ ++GP+
CP002026_0 296 --LVQESWHGAALIDMVRSQLGHHIDRENSQVSVTGPN 331
Histogram of all scores:
score obs exp (one = represents 14 sequences)
----- --- ---
-15 1 0|=
-14 8 0|=
-13 41 0|===
-12 274 0|====================
-11 401 36|==*==========================
-10 617 458|================================*============
-9 806 1134|==========================================================*
-8 824 1177|==========================================================*
-7 576 790|========================================== *
-6 331 431|======================== *
-5 213 213|===============*
-4 146 101|=======*===
-3 75 47|===*==
-2 55 21|=*==
-1 29 9|*==
0 15 4|*=
1 4 2|*
2 2 0|=
3 6 0|=
4 3 0|=
> 5 4 -|=
% Statistical details of theoretical EVD fit:
mu = -7.9989
lambda = 0.7843
chi-sq statistic = 4136.9741
P(chi-square) = 0
Total sequences searched: 4431
Whole sequence top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 20K
Domain top hits:
tophits_s report:
Total hits: 1
Satisfying E cutoff: 1
Total memory: 21K